Cuma, Nisan 03, 2015

tatil gunlerini niye seviyoruz adli post

kafamin icindeki clubber yine 'issstatistikissstatistikisstatistik' diye ritm tutuyor.
lisansta ogretilmeyen istatistikler siye sovmeye basliyorum, lan hadi lisansta ogretilmedi, yuksek lisansta yasam bilimlerine dogru kayinca sen kendin niye bir ders bulup almadin degil mi?

repeated measures datada, lineer regresyon ve comparing slopes gibisinden seylerle debelenirsin sonra boyle, bir de salak master ogrencisinin gotunden yalan yanlis yazdigi teziyle beyni yikanmis supervizorune isin aslinda tam olarak oyle olmadigini anlatmaya calisirsin, falan.

neyse efenim, basligimiza geri donersek, bugun paskalya tatili basladi ve ne super oldu bombos ofis bana kaldi :) sessizlik icinde calismayi ozlemisim.

bu haftaya damgasini vuran cilginli firtinadan sonra bugun gunes acti, iyi oldu boylece normalde tatillerde ofise gelecek insanlar da gelmedi sanirim :)


neyse ben geri doneyim isime gucume...

Perşembe, Mart 26, 2015

bir de

hani germanwingsin ucagi dustu ya fransada, ucak kazasinda olmekten cok kafama ucak dusmesi gibi bir kabusum var benim evet, cok korkunclu tekrarlayan kabus serilerimdendir kendisi cok eglenceli(!) degil mi? bir bilincalti stili olarak donnie darko. Donnie Darkoyu izlemeden, Donnie Darko cekilmeden falan once de vardi bu tekrarlayan kabuslarim, filmden cok etkilendim de ondan oldu gibi bir durum degil yani.

it's been a haard daays night and I've been working like a doog

Gecenlerde 'iyey geymz, çellinc evriting' baslikli bi yazi yazmistim, basi soyleydi:

dun yine aksam vakti isten cikmis eve yuruyordum, cunku yogaya gidecek enerjim ve vaktim yoktu ve cunku kafam cok yorulmustu ve cunku yogaya gitmedigim ve bu hafta cok da spor yapacak vakit bulamadigim icin/ya da ozetle icimden gelmedigi icin diyelim vicdan azabi cekiyordum ve cunku stres dolayisiyla binge eating modunda oldugumdan yani ozetle stres yuzunden bokbogaz oldugumdan hem midem sikayet ediyordu hem de ayrica vicdan azabi duyuyordum cunku zaten cogu aksam eve yuruyerek donmeyi tercih ediyorum evet, yokus asagi, oh mis. Neyse iste, eve yururken sehir merkezinde yine siyah jant kapaklarinin altinda kirmizi jantli bir spor araba gordum ( sadece fren diskleri mi kirmiziydi yoksa komple jantlar mi derseniz, o karanlikta secemedim ama ben gorebildiysem bence komple jantlar kirmizidir, guzeldir falan). Kafamin icindeki ses yine yukarida soyledigim seyi fisildadi bana "iyey geymz, çellinc evriting" diye, ve evet farkettiginiz uzere bunu biraz aksanli yapti, napalim en azindan alman aksaniyla yapmadi bunu. Tubingen gibi kasaba sayilabilecek bir yerde o kadar o kadar o kadar cok luks araba, yeni araba, pahali araba, spor araba olmasi, spor arabanin burada yasli teyze fantazisi olmasi, bkz her uc teyzeden besine spor araba dusmesi, bkz tubingenin aslinda toy town olmasi, bkz misal Mazda MX5'in bir sekilde esantiyon olarak dagitilmis olduguna artik inaniyor olmam (need for speed demisken NFS undergrounddaki guzel arabadir ya Mazda miata, kafamin icindeki ses epey fisildiyor bana anlayacaginiz yolda yururken). 

Sonrasinda hayat nedir, akademide napilir, Almanyada akademisyen olmak, muhendislikten yasam bilimlerine gecen kafam neredeymis acaba,  gibi konularda serbest cagrisimla birbiri ardina gelen ve kacirilan dusunce trenlerini ucuca eklemeye calisan bir sicmik yazisi oldugundan kendisini yayinla tusu yerine taslak olarak kaydet tusuyla odullendirmistim.

Yani ara sira seni de kendimi de dusunuyor, yaziyorum sevgili okur, ki deli bir calisma temposuna girmis olmama ragmen yapiyorum bunu bak, ama kusmuk ve sicmik yayinlamak istemiyorum artik, bilmem o konuda anlasabildik mi?

Baslik farkettiginiz ya da etmediginiz uzere The Beatles'in A Hard Day's Night adli eserinden.
Gecenlerde akademide haftada 80 saat calismam gerek/ 80 saat calisiyorum miti uzerine bir yazi okudum, gotunuzden uydurmayin oyle seyler diyordu ozetle:

bi de gercekten calistigin saatleri bir kaydetsen oyle olmadigini anlayacaksin diyordu insanlara, ah sorunlarimizin cogu akademisyenlerin gercek dunyadan habersiz olmasindan, profesyonel yasamla hic alakalari olmamis olmasindan kaynaklanmiyor muydu zaten?

yani sabah 9 aksam 7 ofiste olman gunde 10 saat calistigini o kadar gostermiyor ki ozellikle akademide, yemek molasi, kahve molasi, gunun yarisini oyle ya da boyle konusarak gecirmek falan seklinde gidebilir o liste.

bir ara pomodoro teknigi ile calisiyordum, ofiste yemek saatleri haric 8 saat dursam bile max 6-7 saat calisabildigimi farketmistim.

neyse, ofisin oldugu koridorun ofisten sessiz olmasi gibi baska sotunlarim var benim, gunde 15 saat de calissam, sessiz bir ortamda 6-7 saatte yapabilecegimden fazla is yapamam herhalde, yani analiz neyse de okuma ve yazma kisminda tikaniyoruz.

Bir de dun twitterda soyle bir sey gordum cok guldum:

spm'de grup analizi icin dana once denemedigim  bir sey deniyorum, olmadi, blog arasi bittikten sonra donup onu cozmem gerek.

o kadar cok es zamanli projem var ki, yapmak istedigim binlerce yeni sey var, motivasyonum da var ama eve gidince pili biten energizer tavsani gibi oluyorum, koltukta bir seyler atistirirken dizi izleyip uyuyakalan isirganotu mode on.

cok ilginc konular var ama, kafamda yeni websiteleri bloglar falan var, bi gazagelerek baslarsam ne guzel olur. Bir yandan da doktora yaparken bi suru is basaran, uluslararasi sosyal yardim projeleri falan yapan insanlar var, bir de biz variz boyle iste,  amacim sikayet etmek degildi aslinda bu yaziya baslarken ama herkesi cok da ciddiye almamak gerek, sanirim bu konuda kendimi daha cok gelistirmeliyim. Insanlar bir seyler basaramadikca egolari buyuyor, saldirganlasiyorlar, arkadasliklari keyifsiz oluyor falan. Insan iliskileri en zor zanaat. Bi suru konuda kendimi gelistirmem gerek, doktorayi bitirdigi labda pinekleyip vakit gecsin diye bekleyen insan olmak istemiyorum ben, kafamda cok sey var yapacak. Oyle iste. Bir ara anlaticam, soz. Daha da guzeli, bir ara onlardan bahseden bir blog yapacagim, buraya bir yerlere de linkini koyacagim.

Ben SPM (Statistical Parametric Mapping- MATLAB'da norogoruntuleme icin kullanilan bir toolbox, hatta en yaygin kullanilanlardan biri) 'de grup analizi icin yazdigim batch skriptimde grup contrast manager kismi niye siciyor, niye istedigimi yapmiyor, sectigim secenek acaba dusundugumden farkli mi calisiyor? Ay cok heyecanli :D

Çarşamba, Ocak 14, 2015

Fieldmapping ile ugrasirken ben...

Yeni yil gelmis olm soylesenize. Neyse yazin yaptigimiz deneylerin sonuclarini analiz etmeye calisiyorum. Besinsizlikten midir vitaminsizlikten midir nedir salaga baglamis hissediyorum kendimi. E tabii motivasyon eksikligini de unutmayalim.
Gecen persembe sonunda endoskopi yaptirdim burasi yavas memleket oldugundan bu cuma falan biyopsi sonuclarini konusmak icin doktora gidebilirmisim. Gastrocu rontgen teknisyeni gibi calisiyor ben bir sey diyemem seni buraya gonderen doktora git dedi. Peki dedim napayim. Sedatif kafasiyla ruyamda modada yuruyordum, beni uyandiran hemsireye de e ben ruya goruyordum tadinda bir seyler zirvaladim. O kafayla ruyada modada gezmek makine seslerini de trafik gurultusu olarak ruyaya katmak sukela dogrusu. Sukela ne ya kendimden tiksindim bir an.
Of calistigin konu ve aletler falan hakkinda yeterli teknik ve pratik bilgi bulamamanin gozu korolsun. Neyse tek basima anlamak icin inat ettigim seyi sonunda harward in mi ne neuroimaging centerinin faqsu sayesinde anladim. En azindan bu da bir seydir.
Dun ucuncu hobbit filmini izledik sinemada ve utanmadan arlanmadan diyorum ki bence epey sikici ve uzundu film.
Radyoda yine wonderwall caliyor ve ben yine bagira bagira eslik etmek istiyorum. Bir de ergen is arkadaslarimin ofiste ergen deodorant sikip kikirdesmelerinden kurtulmak istiyorum cok mu?
Neyse ben spm manualinde fieldmapping kismini tekrar okumaya geri doneyim. Su datayi da analiz edip bi kac denek daha bulursam guzel seyler olabilir.
O zaman siradaki eksen parcasi hepimize gelsin: gold on the ceiling black keys'ten. O degil de neredeyse bir senedir kenarda oturan ukuleleme bi el atsam ya. Amanin en azindan yogaya geri dondum.
Bir dahaki yaziya kadar kib byys falanlar efenim

Pazartesi, Aralık 29, 2014

Flow, My Tears, The Policeman said

Baslikta gecen kitabi okumayi yeni bitirdim, sanirim bu yil bitirdigim son kitap olarak listelere girebilir kendisi.
Philip K. Dick ne güzel de anlatmis zamaninda senin, benim, hepimizin, siradan modern insanin kabuslarini, distopyalarini, bundan yaklasik 40 yil önce hem de.
Noel tatili, yani benim resmi olarak tatilim yok ama cogu insan sehir disinda falan oldugundan ise gitmesem de olur, ama bitirmem gereken isler de var gitmek de lazim o yüzden. Bir yandan da hava inanilmaz soguk, kar yagiyor falan filan iste.
Yazip yazip siliyorum, ben bi disari cikayim bari.

Pazar, Aralık 07, 2014

o degil de

eski yazilarimi okudum, ne kadar naifce mutsuz olmusum, siirler yazmisim, sarkilar dinleyip paylasmisim, espriler yapmisim. Kendimi cok mal gibi hissettim su anda, sanki önceden daha bir insanmisim lan.

akilsiz baslar vs yorgun ayaklar

neyse efenim, bi önceki yazidan devam: öncelikle 1 ay arayla iki partimsi verdigimiz icin insanlarin getirdikleriyle birlikte bir sarap koleksiyonumuz oldu ve an itibariyla evde sarap icen yok, evet.
sonraa, burada hava cok anlamsiz soguk. gece gündüz 1.3 derece civarinda seyrediyor, zaten tahminen 10 gündür falan günes de yok, e bari kar yagsin diyorum, insanlar üstüme yürüyor arada :D

sehirde cikolata estivali var ve benim cikolatadan itinayla uzaklasmam gerekiyor. Ac kalmak da gastrite pek iyi gelmediginden, dün disarida acikinca kendimi en yakin bakery'den bi minik ekmekcik (bagetcik) almis kemrirken buldum sokaklarda. Evden cikarken cantaya atilacak bir seyler hayat kurtarirmis.

Herkes noel alisverisi cilginliginda, cok sirin :)

Etrafta bir sürü güzel noel pazari (christmas market) var, gezmek lazim.

Bi de alakasiz da, mide sicarindan dolayi kahveyi (ve cayi, kafeini) biraktim, cok cilgin oldu. Yillardir devam eden kahve bagimliligimi birakmak ilk bir haftasinda rahatsiz ediciydi evet,  ama sonrasinda bir seyim kalmadi.

Soguk hava sayesinde bol bol film izliyorum bu aralar, o acidan iyi oldu. Dünden önceki gün predestination diye bir film izledik, güzeldi bence. Cok Nolanvari bir konusu vardi. Arada 3 ve Oh boy diye iki alman filmi izledim, onlar epey güzeldi. Movie night yapip milyonuncu kez mating habits of earthbund human izledik, herkes cok eglendi.

Yarin bir arkadasimin dogumgünü, annesi dogumgünü icin kendisine plakcalar aldi, ben de dogumgünü hediyesi olarak cok cilginli sarkilardan olusan bir Beatles albümü aldim :D Heyecan verici, umarim o da sever ve umarim onda yoktur ( Beatles sevdigini biliyorum evet tabii ki, mal gibi kiza gidip sadece kendi sevdigim bir sey almadim yani).

Neyse gideyim de izleyecek bir seyler bulayim, cok da uyku getirmesin cünkü yemeklerden sonra en az 4 saat beklemem gerekiyormus ve 3 saat falan yetmiyor, ve bir sekilde midemdekiler bütün gece orada takiliyorlar, sindirilmiyorlar bana kalsa.
bir aydir itinayla cekilen mide agrisina yenik düsülerek cuma aksami doktora gidilir, yaklasik bir bucuk saat bekledikten sonra bir güzel gastrit teshisi ve doktorun gevezelik arasinda korkutmasiyla ve iki tane cok "sirin" mide ilaciyla eve dönülür. Zaten bir aydir pek bir sey yemiyordum canim, sagol. Doktora yarin yine gidilecek, bu konusma daha bitmedi hem seni gastroenteroloji uzmanina gönderecegim falan dedi, hem de ben bir süredir pek bir sey yemdigimden kan tahlili yaptirmak istedim, etyemez oldugum icin de arada trip atmadi degil. Bir de cok yogunum epey beklersin, yaninda kalinca bir kitap getir oldu adam, evet hasta dolu bi odada beklemek gercekten beni cok iyi hissettiriyor, kesinlikle lan bu insanlardan kimbilir ne virüsler giriyor vücuduma falan diye düsünmüyorum, olur mu canim öyle seyler, sacmalama. lalalalala...

E peki ben nereden protein alacagim sevgili mofuyuminciklamakisteyensevgipitirciklari? Saniyorum bu mideyle baklagiller pek iyi anlasamadilar-denemedim degil. Tofuyla da iyi anlasabildiklerinden emin degilim, seitan deneyeyim desem zaten normalde de sindirimi zor bi kanka. Normal insan olayim, peynir yumurta falan yiyeyim dedim, süt ürünleri ve yumurta da mideyle iyi anlasamiyor, zaten bunca aradan sonra laktozsal ürünlerle midem saglam olsa bile bagirsaklarim siddetli gecimsizlik yasiyor. Abi bu inflamasyon sadece mideye has cikmayacak ve janjanli yiyecek intoleranslarim falan cikacak ya bence, hadi bakalim. Southparkla birlikte glutenfree manyakligina az gülmedik hepimiz, itiraf edelim, neyse artik napalim. Ofisten bir is arkadasimin 2 yil kadar önce saniyorum hemen her seye alerjisi cikti ( öncelikle fruktoz alerjisi var kendisinin, sonra laktoz alerjisi, soya alerjisi gibi seyler de cikti). Amaan, neyse.

Stres yapmaymis, tabii canim, demesi kolay. Ben bugün kosuya cikmadim ulan diye bile stres yapabilen bir insanim, onu napacagiz?Haftada 2-3 kere yogaya giderek bile anca bu kadar oluyormus bak.

Makale taslagimda süpervizörün verdigi düzeltmeleri bitirip ona geri yollamam gerek mesela, bir hafta oldu daha bitmedi.

Ya da  aman evde bos oturmayayim diye aciyorum courserada video izliyorum mesela.

Neyse, bir de keske aileme söylemeseydim öff aman ne vesvese yaptilar, sanirsin ki dünyanin en ender hastaligina sahibim, ulan hepinizin midesi sicmis durumda, farkinda degilsiniz belki ama kaaliiitttsaaaalllll!!!

neyse, yine dök icini rahatla platformu oldu burasi.

Salı, Kasım 04, 2014

isirganotunun anlamsiz kabuslari dükkani

o degil de, bir gün isirganotunun anlamsiz kabuslari dükkani acacagim, gelenlere her gün hikayeler anlatacagim, ya da baska biri anlatacak, yani esasen millet hikayeler dinlemeye gelecek, ben de yan hizmet olarak kafe gelirlerinden para kazanacagim, nasil? Bence tutar ya, ekmek teknesindeki kahvehane misali :D
z planindan da sonra z+1 plani olsun bu, cünkü z planimiz her sey boka batarsa izmire gidip kahvaltici acmak ya iste, ondan. Kedili kahvaltici oluruz en kötü iste, fena mi?
gecenlerde bir kabus olarak patronum A. laba daha cok insan aliyordu, yeni master ogrencileri neyim gelmisti, laan nasil sigacagiz cok kalabalik oldu nasil calisacagiz diye dertleniyordum rüyamda, kabusa gel. Napayim arkadasim, ofis cok ama cok kalabalik, yani birileri gidiyor diye sevinirken paso yenileri geliyor. su anda herkes ayni anda gelse 11 kisiyiz mesela, ki bi kiz baska binada calisiyor onu saymiyorum bile.
dünden önceki gün de kabusumda yogaya gidiyordum, yanimda kiyafet (bkz tayt) götürmeyi unutmusum, laan kot pantolonla da olmaz ki ama diye dertleniyorum, bu hafta bir kez eksik yoga yapicam diye.
ani biriktirmek lazim dedik ama gördügün gibi dünyanin en anlamsiz kabuslarini biriktiriyoruz, oysa su siralar bana kalsa kafam da bir rahat ki sorma.
ani biriktirmek demisken, 2. geleneksel cadilar bayrami partimizi verdik, filmlerimizi izledik falan güzel oldu. Joker ve Harley Quinn olarak couple kostümüne girdik, kiyafetler ve makyajlar el yapimi tabii, olayin güzelligi orada, amatör kostüm gecesi ve yarismasi yaptigimizdan dolayi :)
neyse ben laba gideyim.

Cumartesi, Ekim 25, 2014

Enjoy the silence bence

Radyoda enjoy the silence calarak beni yillar yillar oncesine goturuyor yine, artik aklima daha ziyade odanin kosesinde duran bilgisayarimin basinda gecirdigim sayisiz saatler, programlama odevleri dolu aksamlar geliyor. Etrafimdaki hirs küpü insanlarin bilgisayar konusunda bi bok bilmeyip ahkam kesmeye calismasi bana eskiyi daha da cok özletiyor sanirim. Neyse, bu da gecer elbet.

Epey once yazacaktim buraya, bir ay kadar önce. Diyecektim ki, hayatta ani biriktirmek önemli sey. Ani biriktirmeyi unutmamali insan. Eylülde iki hafta kadar Türkiye'ye gittim, aile ziyareti falan, denize günese kuma doydum azicik, sonra Istanbul'a gittim, H ve U ile kaldim 3 gün, H ile epeydir basbasa vakit gecirmemistik, cok iyi geldi. Onu anlatacaktim sana blog, sonra yillardir görüsmedigim cok eski bir arkadasimla bulustum, insanlarin young adult hayatina adapta olmaya claistigini görmek- acikcasi biraz rahatlaticiydi. Hem yalniz olmadigini bilemk hem de baska türlüsünün mümkün oldugunu görmek cok güzel bir his. Burada alman köylüsü is arkadaslarimdan biri- kendisini pek sevmem de- ay iste yasitlarimizin cocuklari var, ev yapiyorlar insan özeniyor gibi bir seyler dedi gecenlerde. Ev YAPIYORLAR ne laan, aliyorlar da degil, yapiyorlar, o kadar alman köylüsüyüz ki. Off...Sabaha kadar miyavlayan kedilerim bana, üstünü sagini solunu kapatarak kediler icin güvenli yapabilecegim bir müstakil bir bahcesi olan bir evde oturma istegi uyandiriyor, evin benim olmasi büyüklügü falan mühim degil, sadece istedikleri zaman disari cikabilsinler ve ben de güvende olduklarini bileyim yeter :)

Yarin yillardir hayalini kurdugumuz Neuschwanstein kalesini görmeyi yapilacaklar listemizden cikarmaya gidiyoruz, yeyy!

Burada sevdigimiz ve arkadas olarak gördügümüz insanlardan biri baska bir sehre tasiniyor, her akademisyenin kaderi sürekli yer degistirmek ve arkadaslarinin sürekli yer degistirmesi degil midir? Modern zaman göcebeliginin farkli bir versiyonu. Iki gün önce veda partisi tadinda bir sey yapti evinde, tanidigimiz hemen herkesi tanidigi halde (bizim labdaki nisanlar vb) bir tek bizi cagirmisti, diger cagirdigi insanlar da bizim gibi insanlardi, güzel bir ortam vardi. Labdaki insanlara söylemedim cünkü böyle durumlarda neden kendilerinin cagrilmadigni ve benim neden bu insanlarla hala görüstügümü anlamak istemiyorlar genelde, insanlar epey garip. Ha bir de bizim labdan da birinin veda yemegi gibi bir sey vardi, bir yilligina baska yere gidiyor, tabii baskalarini kendilerine tercih ettigim gercegine genelde epey bozuluyorlar- özellikle patronum. Süper pro bir iliskimiz var lab icinde, evet :D

Queens of the stone age I sat by the ocean diyor simdi eksende, ben de istiyorum ben de ben de diye bagirmak istiyorum!

H ile U, her sey yolunda giderse iki ay icinde Amsterdam'a tasiniyorlar, bu son zamanlarin en heyecan verici haberi!!! Herkes yakinimiza geliyor, ne güzel lan :Dy akin=vizesiz ve trenle gidilebilen yerler benim icin sanirim.

Epeydir pek film izlemiyorum sanirim, bu aralar pek kitap da okuyamadim ama Türkiyedeyken Buket Uzuner'den Su romanini okumustum ve bence cok güzeldi. kediler kadiköyler, samanlar falan güzel olur tabii benim icin :D

Yogaya basladim ve epey saridm, haftada 2-3 kere yogaya gidiyorum, hatta ingilizce ders yetmedi kadinin verdigi almanca derslere de gidiyorum, saniyorum almancam da gelisiyor biraz böylece. Aylik abonman aldim, böylece istedigim kadar derse gidebiliyorum. Vücudumda bilmedigim kaslar calisiyor ve esniyor, üstelik sirtim cok daha az kütürdüyor artik, yemin ederim genclestim resmen.
Bir de her modern insanda oldugu gibi saniyorum meditasyon bende de bir ihtiyacmis.

Ohoo eksen, simdi de Coldplayden Clocks caliyor, yine eskilere goturmeli.

 Ilk makalemin ilk taslagi bitti nihayet, bakalim daha üstünde ne kadar degisiklik yapacagiz. Simdi ikincisi üzerinde calisiyorum, datalarim hazir. Aslinda bir an önce bunun taslagini da yazmam gerekiyor, ve ücüncüsü icin de deneylerin yarisini yapmistik, o datalari analiz edip deneyleri tamamlamam gerekiyor. Ha bir de arada baskalariyla birlikte yazilacak en az iki hikaye daha var su an üzerinde calistigim ikinci grup datadan, yani in progress o kadar cok is var ve sürekli gerideymisim gibi hissediyorum ki, stres olmamak zor. Bir de patronum sürekli laf sokuyortrip atiyor falan bu konuda, sorma tadindan yenmiyor be blog. Ofisimiz cok kalabalik ve gürültülü, ergenimsi bir erkek grubumuz var sürekli muhabbet edip kikirdesen, sorma. Neyse pomodoro teknigi epey ise yariyor benim konsantrasyonum icin,  Bir yandan da ney falan dinliyorum, sözsüz müzikler buluyorum falan, napalim. Yazarken ve okurken cok zor oluyor yani, analiz yaparken belki o kadar degil ama.

Arada oktoberfeste gittik, inanilmaz kalabalikti tabii ki ama güzeldi, gerci bildigin panayir yani aslina bakarsan, ya da böyle seyler icin fazla uzun süredir almanyada yasadik sanirim.

Bu da bölüm sonu sarkin olsun canim, eksene sevgilerle:

Cuma, Ağustos 22, 2014

Don't Panic

gunaydinlar sevgili kendi kafasina gore takilan astronotlar ve uzay mekikcikleri

bu kadar nese dolu bir baslangica daha az nese dolu bir gunun sarkisi vererek devam edelim
Ne de guzel soyluyor Coldplay, hepimize nostaljiler yaptiriyor, geri gelmeyecek gunleri hatirlatiyor, album ikibin yilinda cikmis olmasina ragmen bana ikibin bes civari yillari hatirlatiyor, muhtemelen hayatimda en cok o zamanlar coldplay dinlemis olabilirim, ondandir, istiklal caddesinde ve civar sokakalarda simdi varolmayan mukemmel cafelerde takilmayi hatirlatiyor, simdi kimbilir dunyanin kac bir yerinde olan insanlarla kitap tartismayi falan hahitrlatiyor coldplay.

aman neyse, nostalji yapmaya gelmemistim aslinda ama oyle oluverdi. Zaten pazar gunu otuz olacak olmanin verdigi bir mini stres var uzerimde- evet ota boka stres yapmak icin sebep bulan bir stres bagimlisiyim sanirim. Merhabalar ben isirganotu, ben bir streskoligim. adsiz streskolikler toplantisi yapalim online, herkese iyi gelir sanirim.

Aslina bakarsaniz kendimi ikna etmeye calistigim dusunce tarzi soyle, yasasin, otuza kadar yasamayi basardim!!! I made it!!! Ne kadar sakar ve kotu bagisiklik sistemi falan sahibi oldugumu bilen hemen herkesin yuzunde bir gulumseme olacaktir sanirim bu ifadelerle :D Inanmamistiniz degil mi yapabilecegime?

Dun hayatimda bir yenilik yapmaya karar verdim ve yogaya basladim. Bunda tabii burada ingilizce yoga kursu bulmus olabilmemin de katkisi buyuk. sirtimdaki her bir kas ayri ayri agrisa da guzeldi, devam etmeye karar verdim.

siradaki sarkimiz Garden State soundtrackinden gelsin (tabii ki bu sarkiyi filmle birlikte kesfetmis degilim, ama bu vesileyle filmi de analim):

Hadi icinden muzik gecen filmler izleyelim, cok rahat koltuklarimiz ve kitap kapli duvarlarimiz olsun, sarap sevmesek de sangriamiz olsun bir kenarda, mumkunse bol bol dostlar olsun etrafta, filmlerden kitaplardan muziklerden edebiyattan bahsedelim, oruc aruoba okuyalim mesela,  halil cibran okuyalm ne bileyim, dostoyevski okuyalim, almanca brecht okumaya calisalim falan. kicimizi kaldirip ukulele calmayi ogrenelim, bir kenarda sus dursun diye almadik degil mi?

Bleda'nin is bulmasi gibi sahane bir haber var arada, onu da atlamayayim. 9-6 tadinda bir is hayatina girdigi icin biraz mutsuz ama hayat boyle, yapacak bir sey yok.

bir de kedileri tasmayla gezmeye alistirdigimiz icin hem gururlu hem uzgunum. Umarim bir gun sonsuz bahcesi olan sehir merkezinde olmayan ciftlik tadinda bir yere tasinacagiz dunyanin herhangi bir yerinde ve gercek ozgurlugun tadini cikaracaklar.

son olarak bu aralar iki kitap birden okuyorum yine, William S. Burroughs"un Junky'si ve Albert Camus'dan Düşüş.  Guzel Kindle, cici Kindle diyorum ama arada kitap kokusunu, raflar dolusu kitaplarimi, onlari suursuzca karistimayi ozluyorum evet.

Isler gucler beni bekler, buraya gelmeyen yaz yuzunden eylulde turkiyeye gidip deniz kum gunes mi gorsem diye dusunuyorum ama hala emin olamiyorum. Bakalim.

Cumartesi, Temmuz 05, 2014

hadi hep birlikte hep birlikte biz biz olalim

Dün yan köy olan Rottenburg'da TU-CAGO isimli bir blues band dinlerken (hahaha, süper espri degil mi, sikago tükago) yine sunu yapayim bunu yapayim diye gazagelmisken kendimi hayatta yasadigim epiphanyler buradan romaya kadar yol olur laan diye düsünürken bulup bunu bir de telefonun not defterine not olarak düsmek. Zaten telefonun not defterinde en derin psikanalizler yatmakta bana kalirsa, paper notlari, konferans notlari, gidilen seminer talk vb notlari, kendi kendine notlar falan...
Bir de 'Laugh now, but one day we'll be in charge' dersem mesajin sahibi kendisini ve mesajinin bana ulastigini anlar mi acaba :D
aslinda bu mesaji sabahtan beri kurguluyordum kafamda, dün gittigim yan köy meydani kahvesindeki  blues brothers stayla amcalar grubundan ve nasil da ortamin yine en genc insanlarindan oldugumuzdan, nasil da surada aslinda en iyi anlasilacak grubun yine 68 kusagi amcalarla teyzeler oldugundan, yeni nesillerin nasil konservatiflestiginden, aslinda yasadigimiz yerin nasil da konyanin bir köyü konservatifliginde oldugundan vb vb bahsedecektim, üsendim yine. sonra tanimadigim biri blogumdan bahsetti bana bir facebook mesajinda, garip geldi falan.
öyle iste.
kendime not: müzikli filmler listesine sahane bir ekleme: Good Vibrations. Bir de kuzey avrupa yapimi polisiye filmler izlemeyi birak da tekrar feel good movies tadina dön, bak Walter Mitty misal, iki kez izlemek ne de iyi geldi.

Çarşamba, Nisan 09, 2014

Çarşamba, Nisan 02, 2014

Çarşamba, Ocak 15, 2014

what's happiness demisken sarkili post

ya da bkz mad men teaserlari...
bir de ben ay sonunda turkiyeye gidiyorum, tam 1 yil sonra. bakalim neler degismis olacak, bakalim 1 hafta orada kalmak hayatimda ne bok degistirecek, falan.

what's happiness?

Mutluluk, elindeki ekitap koleksiyonunu arkadaslariyla paylasmaya karar veren canin arkadasin H.nin gonderdigi ekitaplar icinde, yillardir okumak istedigin ama yazarinin cani istemediginden yillardir baskisi yapilmayan ve ikinci eli yok satan o kitabin cikmasidir (isimler, kitap isimleri falan basbelasindan sakinmak icin yazilmamaktadir. zaten tahmin etmis olanlara ekstra ipucu: kitap/yazar yerli).
mutluluk turkce ne bulsak da okusak diye dusunurken elinde bitiveren birbirinden ilgi cekici zibilyon tane ekitaptir.
bazen mutlu etmesi kolay bir insan olabiliyorum ben de, evet.
vielen dank, thanks, tesekkurler, tak H.

Salı, Aralık 31, 2013

bu da yilin son postu olsun

bir süredir epey depresifim, düsününce pek de iyi bir yil gecirmisim gibi hissetmiyorum kendimi.
Bir de her zamanki gibi hasta oldum- soguk alginligiyla karisik sinüzit sanirim. Bir yilbasini daha evde pijamalarla gecirdigimi buraya not düsmek istedim.  Bünyeyi ne kadar strese sokuyorsak, dinlenince sapitan bir bagisiklik sistemi yaratmis bulunmaktayiz. Noel haftasi diye dinlenince hasta olmak.

neyse efenim yeni yil yeni yil yeni yil yeni yil siizlereee kutlu olsun, yeni yil yeni yil yeni yil yeni yil biiizlere mutlu olsun diyorum size, tahminimce yanlis yazdim ama anladiniz iste. bir de hic copy paste yapmadim, aferin bana.

kafamda cok cilginli yeni yilda yapmak istedigim seyler listesi, yilin sarkilari listeleri falan var ama halsizim. bir de ocak sonunda izmire gidecegim, bakalim tam 1 yil aradan sonra türkiyeye gitmek ne kadar sürreel gelecek bu zavalli bünyeye.

yeni yilda daha cok mutlu olmak, zamanimi daha iyi kullanmak istiyorum. Resmen bir yili tembellikle gecirdim ya da ben öyle hissediyorum en azindan.

hadi herkese yilbasi hediyesi olarak siber-sarilma hediye ediyorum- karsilik beklemeden. belki hep beraber daha iyi hissederiz.

Cumartesi, Kasım 02, 2013

(yaklasmakta olan) kis depresyonu ve kendine güvensizlik ve body size distortion arasindaki mükkemmelötesi baglantilar

bir cumartesi sabahi (aslinda gidip calismam gerekse de) de biraz keyif yapacaktim. dün de tatildi aslinda ama dün calismak istememistim, persembe günü evde mini bir cadilar bayrami partisi vermistik ve gec yatmistik ve bir kac bardak sangria icmis olabilirdik- bunu yazarken bu aksam da katilmamiz gerekn bir parti oldugunu hatirlamis olabilirdim misal. belki de b vitaminlerimi düzenli icmeyi unuttugumdandi bu blues ruh hali, kim bilebilirdi. persembe günü kendi partime gec kalma pahasina posterimin büyük bir kismini tamamlamistim, ama bugün de gidip kalan eksiklikleri halletmem gerekiyordu, cünkü süpervizörüm yarin amerikaya ucuyordu ve gitmeden önce görmesi gerekmekteydi, benim de posteri pazartesi baskiya vermem gerekiyordu ki, dünyanin en hizli bilisim teknolojilerine sahip olan canim ülke almanyada posteri baskiya vermekle alman arasinda gececek 1.5 gün, posteri gitmedn alip kontrol etmeme yetecek zaman versindi. Ha evet, önümüzdeki persembe amerikaya ucuyor olabilirdim ve bu yüzden epey gergin olabilirdim, epey avrupalilasmis olabilirdim bu konuda, dilini bilmedigim herhangi bir avrupa ülkesine gitmek beni germiyorkan amerikaya gitmek beni feci geriyor olabilirdi. san diegoda hava güzelmis ve pasifik okyanusunu görme serefine erisecegiz iste gibi konularla kafami oyalamaya calissam da aslinda transatlantik ucuslarda ucus korkusu yasadigimi kabul etmem gerekebilirdi.
ise gitmem gerekirken ben oturup dumandan köprüalti dinleyerek nostalji yapmis olabilirdim, sonra bir cumartesi sabahi keyfi nostaljisi olarak acip kanat atkaya okumus olabilirdim, sonra lou reedden perfect day dinleyip velvet undergrounda ziplamis ve favorim olan sarkilardan venus in furs dinlemis olabilirdim, oradan david bowiey uzanip defalarca space oddity dinlemis ve kendimi cok ama cok uzgun hissetmis olabilirdim. Hava bok gibi ruzgarli ve bulutlu ve kapali ve ayni anda gunesli olabilirdi ve arkamdaki koltukta uyuyan kedi horluyor olabilirdi (uykusunda mirildanan, horlayan ya da inleyen bir kedi kendisi, bi sürü kez kayboldugunu düsününce bazen kabuslari icin kendisine üzülüyorum). psikooglarla calismaktan sikilmis ve kod yazmaktan bu akdar uzak kaldigim icin kendime epey kiziyor olabilirdim, nereden tekrar baslayacagimi bilmemenin rehavetiyle oyalaniyor da olabilirdim. kendimi cirkin ve sisman hissediyor olabilirdim,  dün kosmus olsam da bugün kosacak vaktim olmayabilir diye dertlenirken, evde solitaire basinda -sirf is yapmamak icin- oyalaniyor da olabilirdim. Deadlinelardan nefret ediyor ve bir süre kendi kendime kalip kafami dinlemeye de ihtiyac duyuyor olabilirdim.
hepsi olabilirdi, oluyordur da belki, kimbilir. Ben gidip bir kahve daha yapayim, hazirlanip laba gideyim, gözümde büyüyen posteri bitirirsem kendime güvensizligim belki unutacagim kadar geri planlara düser, hissettigim rahatlama karsisinda.

Salı, Ekim 29, 2013

barcelona barcelona sen ne de guzelsin

bu salak alman koyunde cok sikilmistik, malum yaz tatili yapmamis olmak ve aylardir alman sinirlarinin disina cikmamis olmak bunyeye zarar, depresyon etkisi yapar falan. Ryanair kankamiz sagolsun, kendimize bi guzellik yapip gecen hafta iki gunlugune Barcelonaya kactik. Sehir guzel, kizlar guzel, jantlar neden guzel olmasin diye ozetledik 2 gunumuzu. Cidden hayatimda gordugum en guzel yerdi. Yasanir mi? Evet! Insanlar bok gibi degil , mutlular, sokaktaki kopekler mutlu (almanyada cok insan kopek besliyo ama kopeklerin cogu mutlu degil, kimse kuyruk sallamiyor). Sehir buyuk, yapacak cok sey var, cok gezecek yer var, cok turistik, kozmopolit, insan kendini ausländer gibi hissetmiyor. Bir yandan da misal, sehir merkezinde plajlar var! rüya gibi! denize girdik, güneslendik, kumsal cok güzeldi ve dünyanin her yerinden insan doluydu (arkamizdaki amerikali delikanlilar önümüzdeki belcikali üstsüz kiza yavsamaya calisirken ortada kalmis olmak sorunsali).
sonra bu boktan alman köyüne geri döndük- mis gibi yaparak yasayan pretentious insanlarin özenti elitist köyü.
barcelona benim icin, Brazildeki Sam'in rüyalari gibi oldu.  Asa ulasamayacagim ama cok süper mutlu bi hayat ve uyandigimdaki realitem bu boktan alman köyü.
neyse, haftaya da san diego yolcusuyuz bakalim, gidip poster hazirlamak gerek simdi. Böyle böyle her ay daha mutlu bir yere kacmak gerek, burasi cekilmiyor azizim. O yüzden para gerek, boktan phd maasi ile iki kisi yasayinca olmuyor o isler. kendime kizdigim kadar su dünyada.... neyse.
insanin hayattan bekledigi tek lüks gezmek olsun, daha da kötüsü su boktan düzende gezmek lüks bir sey olsun

Salı, Ekim 08, 2013

tasinmacali oyunlar

cok olmus yine yazmayali.
buraya kis geliyor bile, kistan once depresyonu geldi. cok sikiliyorum cok sikiliyorum.
arada bi suru guzel filmler izledim, itler gibi calistim, deney yaptim, ustume yikilan yeni gelmis phd ogrencisine yeterince sey ogrettikten sonra itinayla kendisine onun isini yapmayacagimi belli ettim, tasindik, yerlestik falan filan.
en son before midnight i izledim, serinin en guzel ve en gercekci filmi olabilir, ama bence kadinin karakteri sinir bozucuydu.
sanirim is yasamimda falan bir suru bossy insana katlanmak zorunda oldugumdan- welcome to academics- kisisel iliskilerde en ufak bi bossy hareket ya da manipule etme cabasi sezdigimde- ki bunun genelde bilmeyerek oldugunun da farkinda olsam da- hemen sinirleniyor ve topuklarim gotume vura vura uzaklasmak istiyorum bu insanlardan. 
bu boktan durum aslinda cok oluyor ya da ben buluttan nem kapar duruma geldim. 
tasindik, yerlestik. kediler evi cok sevdi- ev eski eve gore epey buyuk oldugundan olabilir, tum gun camda disaridan gelip gecenleri izlediklerinden de olabilir. epey bi cosy oldu ortam. salona tek kisilk yatak koyup yastiklarla kendisini divan haline getirmis olmamizdan da kaynaklaniyor olabilir tabii bu durum, zira eve her gelen yarim saat sonra uzanir vaziyette kedi gobegi seviyor olarak buluyor kendini. 
ha bir de sehir merkezi sayilabilecek bir yerde oturdugumuzdan gelen gideni bol bir ev oldu burasi, bu da guzel.
almanca kursuna basladim, bu sefer kursu degistirip yeni bir yerde basladim, buradaki ortam asiri asiri ciddi bana gore, sanirsin ki herkes alman olacagim gaziyla gelmis. 
onun haricinde, hala tatil yapamadim ve hala cok cok cok sikiliyorum. Tubingen effect: yeni insanlarla tanismanin zorlugu, olan insanlarla muhabbet etmenin zorlugu falan filan.
neyse ben kacayim da o region of interestler kendi kendilerine tanimlanmayacaklar deneklerin beyinlerinde. 

Pazartesi, Ağustos 19, 2013

guzel muzikli bir film daha

Dun high Fidelity izledim. Yine muzikleri guzeldir tadinda izlemeye baslayip sevdigim filmlerden. Siz sikici bulabilirsiniz belki ama hayat da sikici degil mi zaten? aman allaaam cok uber super aksiyonlu bi hayat yasiyosaniz da arada seyirci olarak davet etsenize, olur mu?
Bu siralar anlamsiz bir nes'e doldum. Sanirsam harbiden b12 eksikligi cektigim icin aptal depresif ve cekilmez bir insan olmusum, tekrar vitamin almaya baslayinca insan oldum. Yok en kotu ihtimal gider izmire yerlesiriz effect de olabilir bu, farkindayim. Doktoraya koymusum, size bir sey olmasin.
Belki de gecen hafta delicesine deney yaptigimdan, MR'da maruz kaldigim manyetik alanin bilinmeyen bir yan etkisidir manik ruh hali, hepsinin gideri var benim gozumde.
Aylardir okudugum kitabi sonunda bitirmeyi basardim, su anki deneyimin ilk asamasini bitirdim verileri analiz ediyorum, yeni ev sahibi sonunda tatilden dondu ve mail yazdi, izledigim filmleri seviyorum bu aralar, yarin Frankfurt'a gidiyoruz, amerika vizesi icin gorusmem var (sanirim 7 ay falan aradan sonra gokdelen gorecegiz, yeey! 3 aydir da buyuk sehir gormemistim, oyle dusun yani). Gecen yilki gibi cok cok iyi davransinlar, mukemmel sorunsuz olsun ve ertesi gun vizemi yollasinlar, olur mu?. Ben de biletimi de alayim ve okuldan butun bu islemlerin parasini alayim bir an once, hemen 10 gunde versinler.
yine dogumgunum geliyor lan, fazla buyuduk bence. burada sabitlenebiliriz.
burada evi teslim alirken ve teslim ederken bir protokol hazirlaniyor (devir protokolu gibi de janjanli bi adi var kendisinin). Neyse iste, boyle aman tmeiz birak evi, bal dok yala olsun falan tadindalar genelde. Ben de, bir ay sonra tasinacagimizdan, ufaktan ufaktan evi temizliyorum ki cikarken kolay olsun. 2-3 keredir delicesine banyo temizliyorum temizliyorum, fayanslari ovuyorum falan, delirecegim. o kuvet kenarindaki silikonlardaki sararma azalacagina artiyor resmen, ulan bu kadar pis insanlar miyiz diye kurt dustu icime :) Megersem eski, eski kiracilardan biri, pis silikonu temizlemeden uzerine seffaf degil de beyaz silikon cekmis, sirf o protokol kismini gecebilmek ve depozitosunu alabilmek icin muhtemelen. Ben de 'derinlemesine' temizledikce yuzeydeki silikonu kaldirmisim, altindaki pislik meydana cikmis. O kadar rahatladim ki anlatamam. Ha henuz bir cozum bulmadan bu kadar rahatlamis olmam da ayri bir mesele ama olsun.
Bir kod calistirdim ve eve gitmek icin bitmesini bekliyorum. sabah 5.15 gibi evden cikacagiz ve 9.15 gibi vize gorusmem var, bana bol sanslar. Neyse bari bir seyler izleyeyim, madem daha buradayim.

Çarşamba, Ağustos 07, 2013

tuhaf aile

disaridan bakinca, dusununce ne tuhaf bir aileyiz biz lan (normal aile diye bir sey vardi sanki de), biyolojik olarak bir bagim olmayan simdiki annem (sanirim halk arasinda uvey deniyor buna, hic sevmem bu kelimeyi, hakaret gibi gelir), bayram vesilesiyle dun kendi annemin mezarini ziyaret ettigini, ona torunlarini anlattigini ama bizim evlendigimizi anlatmadigini, unuttugunu, onu da bir dahaki sefere anlatacagini soyledi. Bu ilk kez de olmuyor, annemin mezarini 10 yildan uzun suredir ziyaret etmemisimdir, dusununce o benden cok ziyaret ediyor, hos annemi de benden cok taniyor, hatirliyor falan. ablamin ufakligi goturmek istemis, olmamis. Yahu cocugun aklini niye karistiriyorsunuz diyorum, anlamiyorlar. Benim cocugum olsa, kendi annemin olmus oldugunu falan cok sonra soylerdim herhalde, onemsiz bir sey yani bence torun acisindan. ulan ben annemi hatirlamiyorum, o cocuga ne? Ayrica ablamin ufaklik "annane'sini cok seviyor falan, niye cocugun kafasini karistiriyoz ki?
ben cok ruhsuzum sanirsam.

Salı, Ağustos 06, 2013

asil yazacagim seyi unuttum

Dun biz sunu izlemeye basladik:
Bence epey gercekci, uzgun ve eglenceli ayni zamanda. Adam boyle hayat bu sicar ama napalim tadinda

gunlerden bir gun yine kahramanimiz mofu...

salak mofu, dun komsunun evine girmis, aradik taradik sesini duyduk, bir sekilde baska komsularla evin sahibine ulasildi, evde oturan meymenetsiz kadin, evin sahibi yasli bunak denyo alman herifin sevgilisinin kiziymis. Megersem kadinin alerjisi varmismis ve kedilerden sikayetcilermismis (simdiye kadar ne bize bir sey diyen oldu, ne apartman icine yazi asan oldu vb.). Eve tasinirken kedileri sormustum, ve apartmanda baska dairelerde de evcil hayvana izin oldugunu biliyorum. Simdi biraz fasistlik yapabilirim, dileyen bundan sonrasini okumasin.
It herif iste, tipik alman, omru, efendisi gammazlamak, arkadasn konusmak, dusmanlik yapmak, birilerini birilerine sikayet etmek. Ev sahiplerinin yillik toplantisinda sikayet etmisler kedileri. Yani soylesen misal bana, bi konussak, birileriyle iletisim kursan belki insan olmaya sen de hak kazanirsin. Naisl kiziyorum, buralardan nasil nefret ediyorum anlatamam. Burasi icimdeki canavari cikardi, surekli sinirli ve diken ustunde bir insan oldum, suradaki almanlardan cok kurallari kafama takiyorum, insaniyetten nasiplerini almamis, hala savas hinciyla yasayan, yabanci dusmani mahluklar. Neyse cok sayarim daha ama, neyse. Cok yoruyor burada yasamak beni. Surekli olarak bir konusmanin ilk sorusu olarak almanca konusmadigini farkedince sorulan nerelisin sorusu ve o burun kivirma, o kendilerini bir sey sanan aptal tripleri, ne derseniz deyin cogunuz hala irkcisiiniiz. Hala en ari irk benim kafasindasiniz.
Neyse ben boyle, ya kadin dava acarsa ya bir sey olursa ya suysa ya buysa diye kendi kendimi yerken, bleda az once en kotu gider Izmir'e yerlesiriz dedi. Anaaa, ustume gelen o rahatlama, paha bicilemez abii. Sikerler ya, Z planimiz en muhtesem olani, ben boyle hayat stresinin de o stresi yaratan bok yemis boktan isanlarin da sicarim beynine. Oh be!!! Bok almanya, su phdyi bi bitirsem bi bitirsem. Sikerler...

Pazar, Ağustos 04, 2013

bir gün bir gün bir mofu...

Yine uzun zamandir yazmamisim.  Bir süredir o kadar depresifim ki birak yazi yazmayi, hicbir sey yapasim gelmiyor.
Buraya en son yazdigim gün bir ev görmeye gittik, ev fena degildi, görebildigimiz ilk evdi, ev sahibindendi ve ev sahibi pek bir sirin görünüyordu. Kedilere de ok idi. Ingilizce de konusuyordu. Biz de o evi tutmaya karar verdik (bir Tübingen klasigi- görebildigin ilk evi tutarsin). Ev limitimizin biraz üstünde maddi acidan, ama depozitosu yüksek degil, yeri cok merkezi, iki ayri odasi var, simdiki evden biraz daha büyük, mutfagi salonun icinde degil, ayri, banyosu yatak odasinin icinde degil, ayri ( farkettiginiz gibi otelimsi bir evden eve daha cok benzeyen bir eve gecis yapiyoruz). Giris kat yine (kedilerle tercihimiz giris kat), apartmandan ayri girisi var (bu güzel bence). Negatif yanlari: 1. Kirasi daha fazla (bu konuda cok secenegimiz yoktu), 2. Patronuma komsu olacagiz (ayni sokaktayiz, ama yapilacak cok bir sey yok bu konuda da), 3. Balkonu/terasi vb yok (bahce var, ortak kullanimli. Ayrica kocaman bir parkin falan yaninda, bu konuda cok büyük sikintimiz olmayacak), 4. Su anda oturdugumuz evde kilerimiz evin karsisindaydi, tasinacagimiz evde farkli katlarda ve su an oturdugumuz evde holde ivir zivir koymak icin kocaman bir dolap vardi, tasinacagimiz yerde yok.
Bunlarin hepsine ok, cünkü kücücük de olsa gercek mutfagi var :) Ve yeri cok merkezi ve güzel, skagin hemen kösesinde hippie evimiz de var :) Apartmanlarin bahcelerinde minik seralar falan var. sehrin o bölgesi buralar kadar uptight degil sanirim, herkes züpper üstün irk alman olmak zorunda diil yani :D
Gecen pazar acayip bir firtina cikti burada, günlük güneslik havadan ceviz büyüklügünde dolulara gectik, saskin kediler de disaridaydi, cok korktular.
Ondan bir süre önce salak mofunun cenesinde kocaman bir yara farkettik, vet baska bir kedinin isirmis olmasinin muhtemel oldugunu söyledi. Iki gün önce de kafasinda bir yara farkettik, bir kac gündür disari da cikmiyordu 8ve evde kavga ediyor olsalar yerlerde tüyler vb olurdu). Saniyoruz ki doludan yaralanmis, cünkü en gec o salak döndü eve dolu yagarken. Gün gecmiyor ki mofuyla günümüze yeni bir heyecan katilmasin.Neyse, umarim baska bir seyi yoktur ve cabucak iyilesir.
Tekrar yabancilar polisine gittigimizde bize kira konusunda gecen söyledikleri limitin yanlis oldugunu, limitimizin daha yüksek oldugunu söylediler (kesin bir seyleri gözden kaciriyordur ama neyse). Eger son yaptiklari hesapta bir yanlislik yoksa yeni tuttugumuz ev limitler dahilinde.
Dün Bodensee'ye yüzmeye gittik. Taitle cikamamis ve bir süre daha cikamayacak olmanin depresyonunu yasiyordum kac zamandir.  Delirmek üzereyken bütce dostu bir  secenek olarak Konstanz gölüne yüzmeye gittik. Fotolari güzel göründügünden ve sakin olabilecegini düsündügümüzden Kressbronn'a gittik. Gölde yüzmek ilginc bir deneyim, daha önce yapmamistim hic. Tatli suda yüzdük :) Plaj epey cakilli, gölde kumsal beklemek gibi bir salaklik benden beklenebilir tabii. Epey kalabalikti ama bunaltici degildi. Tesisler cok güzeldi. Agaclarin gölgesinde, cimenlerin üstünde yatabiliyorsunuz. Kabinler, tuvaletler, duslar vb var ve temiz. Yemek yiyecek bir yerler var, ve ucuz (pizza yedik 5 euroya, güzeldi de).  Ve bu tesise giris kisibasi sadece 2 euro!!! Saka gibi! 3 kisi gittik, eyalet biletiyle. Kisi basi 10 euroya geldi yol parasi (gidis dönüs). Yani ben mesela Istanbulda yol parasi arti giris parasi 12 euroya böylesi bir plaj keyfi falan yapabilecegime inanmiyorum. Su biraz soguktu, ama yüzülemeyecek gibi degildi. Biz biraz gec gittik, suyun icinde az süre harcamis olduk. Cünkü tekrar girmeye karar verdigimizde hava kapandi, vazgectik. Oradaki insanlarin cogu toparlanip gitmeye baslayinca bir bildikleri vardir diye biz de ciktik, sonra yagmur basladi zaten.
Trenler de cok kalabalik degildi, o yüzden yol uzun olmasina ragmen cok yorucu degildi ve eglendik. Yalnizca Bleda olmasa da, Ceren'le ben, bir tavla getirseydik cok eglenebilirdik bak olduk.
Ara sira yaz haftasonlarini degerlendirecek bir yer olabilir yani, güzeldi. Mutlu oldum, yüzmüs oldum (bir sezonu daha gec de olsa acmis bulunduk), simdi firsat bulursak baska yerleri de gezebiliriz, sadece deniz düsünmekten baska hicbir sey planlayamiyordum.
Amerika'da gecirecegimiz 1 hafta icin sonunda kalacak yer ayarladik, San Diego merkezde ve konferans merkezine yürüyüs mesafesinde bir daire tuttuk. Güzel görünüyor, yasasin! Belki orada yüzecek zaman ve hava olur, olursa güzel olur, Kaliforniya sahilleri ve okyanuslar! Simdi vizeye basvurabilir ve ucak biletimi alabilirim.
Deneyleri de yapmak gerek tabii, sunulacak poster icin.
Yaklasik 6 hafta sonra tasinacagimizdan evi temizlemeye basladim. Burada temiz eve tasiniyor, cikarken temiz birakiyorsunuz. bence güzel bir uygulama. Ama iste normalde o kadar temiz yasamadigimizdan midir nedir, bir sürü is var.
Bleda bir kac ay önce sokakta buldugumuz bisikleti tamir ediyor, ucuzundan bir tane daha bisiklet alirsak süper olur. Tasinacagimiz semt dümdüz, buralar gibi yokuslu degil.
Baska baska, Danish seriye devam ediyoruz, Bleda da izliyor bizi epey sardi.
The girl with the dragon tattoo'yu epey önce ilemistim, gecen hafta the girl who played with fire'i izledim, bugün de The girl who kicked the hornet's nest'i iziyorum. Bence eepy güzel bir seri. Iskandinav olsun bizim olsun ya. Su Avrupada gezdigim sehirler icinde en cok sevdigim de Stockholm idi zaten. Cok gezdigim söylenemez ama olsun.
Bir de gecenlerde Wreck it Ralph izledik, öyle güzel böyle güzel yani. Keske daha önce izleseymisiz, ben o kadar güzel olacagini düsünmemistim. Toy Story ile Monsters Inc. i al, ortaya harmanla, öyle güzeldi.
Ay cok uzattim, benden bu kadar. Yeni bir yere tasinacagimiz icin heyecanliyim, nasil daha 'ev' yapabiliriz onu düsünüyorum. Buralari hic evim gibi hissetmiyorum, bu da depresyonumun sebeplerinden biri, sürekli caresizlik hissi de sebeplerinden biri, ev olarak hissettigim hicbir yer kalmamis olmasi da. Falan filan...

Pazartesi, Temmuz 15, 2013

boktan ayrintilar falan

Uzun zamandir yazmamisim yine. Burnunu boktan cikaramayan isirganotu mode on. Ev sahibimiz, eve kendisi tasinacagindan evden cikmamizi istedi (lütfen hemen akil vermeye kalkmayin, akil veren insanlardan biktim artik. Evet yaptigi sey tamamen yasalara ve sözlesmemize uygun, evet biz de arastirdik bunu). Iste ekim basina kadar süremiz var. Ama burada bir kac sorunumuz var. Misal oturdugumuz ev Tübingen piyasasina göre ucuzdu. Misal tam ekim basi yeni ögrencilerin gelecegi zaman. Misal yabancilar polisi belli bir limitin üzerinde kira verirsek bankada bloke hesap acmamiz gerektigini ve aradaki farki 1-2 yillik olarak toplu olarak yatirip onlara göstermemiz gerektigini söyledi. Ha benim oturma iznimi birer yillik verip uzatiyorken bana hangi akilla 2 yillik para göstermen gerek diyecek, kanuni dayanagi nedir, merak etmiyor degilim. Tübingen konut problemi olan bir ögrenci sehri. O yüzden ev sahipleri kiracilardan kiraci begeniyor. 15 gündür bir tane bile ev görmeye gidemedik henüz, birakin evi begenip begenmemeyi, ya da tutmayi.
Evet üniversitenin ciftler icin yurt-evleri vs var, onu ben de düsündüm sizden önce, merak etmeyin. Ancak evcil hayvan kabul etmiyorlar. Biz burada 2 kisi 3 kediyiz. Tek maasimiz var ve pek cok ev sahibinin gözünde kisa süreli olarak buradayiz (2-3 yil kisa bir süreymis evet). Üstüne üstlük almancasi iyi olmayan yabanci bir ciftiz ve daha da ötesi Türkiyeden geliyoruz (ismimden ve isimden önce nereli oldugumu soranlara selam olsun).
Yani simdi o en ucuz evler hic bir zaman bize kalmiyor. Ya bir eve degerinden cok para verecegiz, ya kimsenin tercih etmedigi, etrafinda hic bir sey olmayan Beckett'in Godot'yu Beklerken'i yazdigi tadda bir köye tasinacagiz (ki o köylerde de evcil hayvan istemeyen cok ev gördüm), ya emlakciya gidecegiz, ki burada emlakcilar ökküz gibi para aliyor (2.38 kira), ben bu evi tutarken vermistim, simdi mümkünse vermek istemiyorum (ki almanlarin emlakciya para verdigini henüz pek görmedim). Ya kedilerden vazgececegiz (yani bu bir opsiyon degil ama hicbir caresi olayana üniversitenin yurdu var iste dendiginde verilecek cevap)  falan filan. Yani surada da paran yoksa hicsin, paran yoksa evcil hayvanin olamaz, paran yoksa sokakta da yasayamazsin, paran yoksa esin geri gönderilsin, paran yoksa bilmiyorum yani, bir cözüm yolu sunani görmedim henüz. sayisiz red aldik iki hafta icinde. Yabancilar polisinin bize ev büyüklügü ile verdigi sinir 24 m2. Oturacagimiz yer minimum 24 m2 olmak zorunda. Ama görebilir miyiz diye sordugumuz evlerin cogu (ki iclerinde 2 oda cok ev var, bizimkinden büyük cok ev var, 40-50 m2 evler var) biz sadece tek kisi istiyoruz diyor. Cogu evcil hayvana izin yok diyor sözde hayvansever olan bu memlekette (simdi bana kedi ama eve zarar verir sagi solu cizer demeyin, hayvan gibi depozito aliyorlar, depozitoyu kesmek icin her seyi ince ince en ufak ayrintiya kadar yazdiklari protokoller var eve girip cikarken, ve  en önemlisi etrafa kendi verebilecegimiz zararlar icin liability insurance yaptiriyoruz, o kedileri de kapsiyor). Yani bir hesap yapiyorum, emlakciya falan gitsem, depozito falan (ki baktigimiz evlerden birinin depozitosu 1550 euro), yabancilar polisine bloke hesap derken bir anda ihtiyac duyulan toplu para 15 bin liraya cikiyor. Yine söylüyorum, su sözüm ona ultra sosyal devlette paran yoksa öl yani.
Bunun yaninda, sen gel benim evi tut, aradaki farki elden ödersin, yabancilar polisine onlarin istedigi kadar gösteririz kirayi diyen Türk amca var misal (o amca cok ayri bir yazinin konusu,  insanlari salak yerine koymada level atlamis bence). Ben buraya geldigimden beri buradaki Türklerden bucak bucak kaciyorum. Bir yanda bu kadar caresiz durumda birakmak insanlari, bir yanda da Ghettolasiyorlar diye söylenmek. Paran yoksa buna mecbursun. Cünkü gecen gün almancamin iyi olmadigini farkedince hemen nereli oldugumu soran teyze, bana burun kivirmaya basladi diye burada doktora ögrencisi oldugumu anlattim zorla (neyse ki miymiyliktan telefonu kapatmamisti daha) o zaman biraz degisti, su gün tekrar ara dedi. Gören de bogazda yali kiraliyor sanacak, random bir köyde sobali, eski bir evi var kendisinin (yil olmus 2013 ve sobali ev, evet).
Yani kendimi üstün gördügüm falan yok. Ama kimse kusura bakmasin, surada kurallara uymak yerine 50 yildir sürekli cheat arayan bir topluluk söz konusu oldugunda, ben ev sahibi olsam ve her  kesimden bol bol secenek sahibi olsam, ben de bana en az problem cikaracagina inandigim kisiyi secerdim. Ben sadece gidip yüzyüze görüsme sansi istiyorum. Bi izin verseniz belki beni cok seveceksiniz stayla.
Yarim yamalak almancamla yerel aksani ara sira anlayabiliyor olmam da ayri bir güzellik.
Bledanin burada calisma izni yok ve calisma izni alabilmesi icin önce is bulmasi, sonra bu isi isteyen alman hatta eu vatandasi olmamasi vs vs gerek ( o Türk amca da ben bunu cözerim diye atlayip bize bildigimiz seyler söyledi burada cok dassakliymismis kendisi, yesinler.  Kendisine bilmedigi vize cesitleri oldugunu anlatmaya calistim sen bilmezsin öyle degile geldi, eminim suradaki researcher vizelerini benden iyi biliyorsundur, hii hii, özellikle son 2-3 yil icinde cikarilmis vizeleri falan. Eminim her gün researcherlar senden yardim istemeye geliyor, tabi canim). Burada ögrenci olmaya calisan bir kac türke yardimci olmus kendisi, dil vizesiyle falan gelmis herhalde cocuklar, ingilizce falan bilmiyorlar, hayati bilmiyorlar, onlari yardimci olmak adi altinda sögüslemis iste (misal evinde kiralik oda vererek vb.). O cocuklar da bizim milletin genel yaptigi bilgim yok ama fikrim var furyasindan tabii, oturma iznin yok mu senin oturma izninde mutlaka part time calisma izin oluyor ama dediler Bledaya, cocugum o öyle degil, sizinki ögrenci vizesi, o  aile birlesimi vizesi. Ama hee höö diyene de, valla bizim durumumuz pek bir nadir oldugundan konsolosluk calisanlarina biz anlattik olayi diyoruz, o zaman bi susuyorlar.
Neyse iste, almancan yoksa is bulamazsin falan dedi bu herflerin hepsi ( o da ayri komedi, adamin mühendislik diplomasi ve buradaki herkesin amerikan aksani sandigi derecede iyi ingilizcesi var, durumu senden az biraz farkli yani, ki ben burada almanca bilmeden calisan pek cok türk biliyorum. almanca bilmemek derken de, A2'yi bitirdi, kassa B1'i bitirir, ki ben su anda B1.1' i bitirmeme ragmen seviye tespit sinavlarinda falan B1'i bitirip B2'ye baslamaya hazir görünüyorum). Ve bize is önerisi olarak, misal buradaki Türk lokantalardan birinde bulasikci olabilecegini (almancasi olmadigindan anca öyle isler yapabilirmis yani), o adamlarin cumartesileri calismak icin bulasikci aradigini, her cumartesi 12 saat ayakta durup bulasik yikamak karsiliginda 50 euro verdiklerini, fena para olmadigini söyledi!!! Ben de cevap olarak deneklerime MR scannerin icinde yatip önlerindeki ekranda fotograflara bakmalari karsiliginda saatlik 12 euro verdigimi söyledim, anlatmaya calistim ama tek dogru kendi bildikleri oldugundan pek bir dinlemekle ugrasmadilar tabii (MR deyince radyasyon veriyorsun tabi ehöhö dedi bir kiz, kendisi tip okumak istiyormus burada, MR'da radyasyon olmadigini anlattim, inanmadi bana). Ulan su sehirde evlere temizlige ütüye gideceklere saatlik 10 euro para veriliyor, gazeteler ilan dolup tasiyor! Ayrica, gider üniversitede staj yapar daha cok para alir laan!
 Bence amcanin önerisi daha sahaneydi, havaalaninda güvenlikci falan olabilir gitsin baksin dedi, kendisine ya amca bisiktirgithele demek istedim istedim cok istedim. diyemedim, 70 kusur yasinda herif.
Suradaki insanlarin herkesi kendileri gibi sanmasi ve 50 yil önce kendi geldikleri durumla kiyaslayarak fikir yürütmeleri beni öldürüyor. Yani insanlar iyi niyetten yapiyor falan diyebilirsiniz ama, biz de SALAK degiliz cok afedersiniz. 2.5 yildir buradayim ve bu 3. ev arayisim, bir sekilde becermisiz, degil mi? Yani buradaki ögrenci arkadaslarimdan falan da, o kadar salakca akil verenler oluyor ki, hi hii biz salagiz cünkü mk, 3 kere yana yakila ev aradim bi benim aklima gelmedi bu cözüm evet, bi akilli sensin demek istiyorum.
Bleda mühendislik yapmak istemediginden web programlama ögreniyor simdi, codeacademy sagolsun. Bu olayin güzelligi, her yerde is var, gördügüm pek cok ülkede acik var, ögrenmek ve uygulamaya koymak icin cok da uzun süreler gerekmiyor (en azindan simple seyler yapip bir yere stajyer olarak basvurmak icin), yerden bagimsiz olarak evden de calisabilir (calisma iznine gerek kalmayabilir böylece, cünkü Türkiyede hala aktif banka hesabimiz falan var).
Bütün bu cözümsüzlükler silsilesi icinde, Türkyede durumlarin bu kadar bok olmasi da ayri bir güzellik, ayri bir stres kaynagi. Hicbir sey bulamazsak ve birimiz ya da ikimiz de dönmek zorunda kalirsa ne olur? Olmasin, kalmasin.
Poff bi sürü deney yapmam lazim yine.
Gezmek istiyorduk bu yaz ama nasil yalan oldu anlatamam.
Bu arada, cok süpper sosyal devlet olan almanyadan baska bir ilginclik söyleyeyim size: Burada 5 yil kalana yerlesim izni (sinirsiz oturma izni) veriyorlar. Buraya kadar ok. 5 yil sonunda almanca bilginizi, demokrasiden anladiginizi falan kanitlamaniz gerek. Bunlar da cok mantikli seyler. 5 yil sonunda hayatinizi idare ettirebilecek sekilde para kazanmaniz falan gerek, e bu da cok mantikli. 60 ay boyunca emeklilik primi ödemis olmaniz gerek. Hö? yani diyor ki, bize para kazandiriyorsan aslansin kaplansin. kazandirmiyorsan hicbir hakkin yok. Durumu söyle izah edeyim, örnegin biz burs kontratina sahip oldugumuzdan vergilerden ve öyle kesintilerden muafiz.Aman almanyada sinirsiz oturum da eksik kalsin, cok merakliydim. Insanlarin garip iddialari uzerinde yerlesim ve calisma izniyle ilgili haklari arastirdim da tekrardan. Yani sonucta burada 4 yil falan zaten kalacaksak 1 yil daha kalmaya degebilir mi diye bir merakti iste. Onun haricinde, türklerin aile birlesimiyle falan buraya gelirken dil sinavindan muaf tutulmak icin , ya da iste buraya kacak geldiginde burada kalmak icin buldugu cheat i ogrendim: cocuk yapin. Yani var ya, bir yandan bize yapilan seyleri cok iyi anliyorum, bir yandan da sapla samani ayiramadiklari icin sinirleniyorum. Su ülkede marketten ekmek falan almak icin gerekli almancayi ögrenmeden buraya gelmek icin cocuk yapmak. Aferin. Nasilsa devlet bakiyo degil mi?  ya da devletten aldigi parayla gecinmek icin 8-10 tane cocuk yapmak. Ondan sonra tabii ev vermezler. Senle mi ugrassin adam?
O yüzden diyorum ki, yabanci korkusu olmayan toplum yok, sadece daha disa acik, ya da daha kapali toplumlar var. Ve lanet olsun, dünya genelinde durum pek de iyiye gitmiyor.
Böyle de boktan durumlar, boktan ayrintilar icindeyiz yani. Danimarka yapimi bir polisiy dizi izlemeye basladim, Kanat Atkaya'nin da öve öve bitiremediklerinden biri. Arada almanca sagolsun Danish anliyoruz ya, en cok ona egleniyorum. Surada 2 yil daha kalacaksam en azindan C1'i falan bitirmek ve mümkünse DAF almak istiyorum, böylece Avrupada kalirsak bir takim dilleri cok daha kolay ögrenebiliriz hem. Bir de benim derdim burada baska dillerin kursuna gitmek icin almancamin hangi seviyede olmasi gerek acaba? ( atiyorum, ispanyolca ögrenmek istiyorum, e  buradaki almanca kursu almanca olarak veriliyor tabii). Mesela benim almanca kurslarim ingilizce tabii, derslere ilk basladigimda sinifin yarisi amerikaliydi, bazen ingilizcenin anadilim olmadigini da hatirlatmak zorunda kaliyordum onlara, muhtemelen akillari almiyordu cünkü bir kismi hayatinda hic yabanci dil ögrenmemis. Yabanci bir dilde baska bir yabanci dil ögrenmek benim icin alisildik bir sey yani.
Aman cok uzadi, ben laba gideyim

Pazar, Haziran 30, 2013

son zamanlarda izledigim en mükemmel film

Film 2009'dan The Boat That Rocked- Pirate Radio
Biraz gec kalmisim evet izlemek icin, ama yani son zamanlarda izledigim en mükemmel film.
Film 60'li yillarda UK'de korsan yayin yaparak insanlarin rock müzik dinlemesini saglayan radyolari konu aliyor. Hayali bir radyo üstüne. Bu hayali radyo, Kuzey denizinde bir gemiden yayin yapiyor. Burada yasananlar, dönemin müzigi, dönemin atmosferi üzerine kurulmus bir film.
Tabii ki filmin UK yapimi oldugunu (ve bunun benim icin ayri bir bonus oldugunu) belirtmeme gerek yok sanirim.
Son olarak tekrar tekrar diyorum ki, keske 60larda yasasaydik, en azindan dünyanin düzenini degistirebilecek kadar naif olsaydik, o güzelim müzik olsaydi, salak muhafazakar hükümetlere o güzelim müzikle kafa kaldirsaydik ne güzel olurdu. Burada tanistigim insanlarin cogu muhafazakarligi savunuyor, cok yazik.
Neyse, bence filmi mutlaka izleyin.

Pazar, Haziran 23, 2013


hepimizin manyak oldugu su günlerde, ne yapacagimi, ne yazacagimi bilemedim. Günlerdir huzursuzca uyanip acaba bu sabah nasil bir cinnet vardi polisin uzerinde diye twittera facebooka kosuyorum. Poff...

Cuma, Mayıs 31, 2013

vegan kozmetiklerle deneyimim

Burada vegan ve organik (bu lafa da gicik oluyorum ama yapacak bir sey yok) ürünler kolay erisilebilir ve fiyat araligi da oldukca genis, her bütceye uygun ürünler bulunuyor. Ben de bütcemi cok sarsmadan farkli ürünler deneyerek vegan ama ayni zamanda her boka alerjik ve problemli cildime uygun ürünler bulmaya calisiyorum.
Body shop ürünlerini severdim ama simdi mümkün oldugunca uzak duruyorum. 
Burada dm diye bir kozmetik ürünler satan magazalar zinciri var, onlarin kendi market markalarindan alverde'yi deneyerek basladim, fiyatlari gercekten cok uygun (bir yüz kremi 3 euro civarinda mesela). Ama üzülerek söylemeliyim ki ciltbakim ürünleriyle ben pek anlasamadim. Roll-onlari cok fenal degil, el kremleri de fena degil.  Sampuanlari idare eder ama istedigim hissi vermiyor, sensitive vücut losyonu gercekten kokusuz katkisiz, güzeldi.  Sac kremini begenmedim. 
Dus jeli yerine mümkün oldugunca kati sabun kullanmaya calisiyorum, alverde'nin kati sabunlarini seviyorum, fiyati uygun ve güzel kokuyor. 
Ben de yüz bakim ürünlerinde fiyat araligindaki bir üstteki ürünü denemeye karar verdim. Markanin adi Lavera. Yüz yikama jeli, temizleme tonigi ve nemlendiricisini kullaniyorum. Ayrica el kremini kullaniyorum, oldukca memnunum. 
Bir baska kozmetik ürünler satan magazalar zinciri olan müllerin kendi markasindan vücut losyonu ve spreyi aldim bakalim onlar nasil cikacak, simdilik memnunum.
Lavera'nin da fiyatlari cok yüksek degil (her bir yüz bakim ürünü yanlis hatirlamiyorsam 7 euro falan civarinda). Ayrica pek cok makyaj malzemesi var, tamamen vegan ve organik ve dolayisiyla cruelty-free. Fiyatlari da uygun, ayrica benim gibi yüzündeki kasintilardan dolayi  makyaj yapamayanlar icin de birebir, göz kalemleri hassas gözlere uygunmus ve gözlerde kasinti yapmiyormus.
Hadi bakalim.

Pazar, Mayıs 26, 2013

yine iki film birden

Bleda Istanbul'da. Gittigi gün evi temizledim, bulasiklari falan yikadim ve ertesi gün de spora basladim :) Ev cok düzenli temiz, birikmis camasirlari yikiyorum paso, düzenli olarak yemek yapiyorum ve spor yapiyorum (bugün üsendim ama haftada 1 gün off gün, onu bugün kullanmis olurum).  Farkli vegan kozmetik markalari kesfettim dün. o güzeldi misal. Makaleye abandim, sanirim bu hafta ilk taslagi bitirecegim.  Courserada bir kac ders aldim, onlarla ilgilenmem gerek, bak yine haftasonu yetmedi :)
Arada kitap okuyor ve film izliyorum.
Gecen persembe günü Warm Bodies izledim.  Internetlere düstügünü H.dan ögrendim gecenlerde, ben de firsat bu firsattir diye izledim. Izlerken acaba Bleda da izlemek ister miydi diye sucluluk duydum ama sonradan ilgilenmedigini farekdince icim rahatladi :) Zombi filmlerine olan istahimla izledigim bu filmi begendim, degisik bir bakis acisiydi, bir zombinin bir insani saldiridan kurtararak ona asik olmasini eglenceli bir sekilde anlatiyor. Bir de zombinin icsesinden dinliyoruz olaylari, bence filmin olayi oydu. Eglenceli ve alayci bir ic sesti kendisi.
Spoiler vermeyelim, ama izlemeye deger bir film bence.
Bugün de yine eski olsun bizim olsun romantik komedi olsun tadina sardim, As good as it gets (Benden bu kadar) izledim. Evet bu filmi izlememistim :) Filmi izlemeyen bir tek kisi falan oldugumdan hakkinda pek de bir sey yazasim yok ama ben iyi vakit gecirdim. Zaten 90li yillarin romantik komedilerini seviyorum, ergenken kuzenimle her haftasonu sinemaya gittigimizden olabilir tabii bu.
Simdi bir makale okusam cok güzel olabilir ama saat de 11 oldu, kitap okuyup uyusam daha mantikli. Haftasonu calisayim diyordum ve calismadim diye sucluluk hissediyorum, hemen her haftasonu olan bir sey bu gerci.
Disarisi soguk ve ben kalorifer acip yatiyorum, yani böyle Türkiye 30 derece falan ve insanlar denize gidiyor ya, o acidan dedim. Kiymetini bilin lan. Gerci cok calismam gerektiginde havanin soguk olmasi pek koymuyor. Ben nasilsa boktan ofise tikili kalacagim diye düsünüyorum, Bir de su makalenin taslagini bitirebilirsem, o Adobe Illustrator ile olan maceram beni cildirtmazsa falan, yazayapacagim deneylerin hazirligini yapabilirim. Bir yazda 3 deney biter mi? biterse de benim tez de biter (umarim) :)