Cuma, Ocak 15, 2016

2016 film vol#2

Geçen gün Pawn Sacrifice adlı filmi izledik. Soğuk savaş sırasında Amerikalı bir satranç oyuncusu olan Bobby Fischer hakkında bir film. Amerika ve Sovyetler arasında satranç üzerinden devam eden soğuk savaşı, Bobby Fischer'in kafasının içindeki savaşla paralel izliyoruz. Filmin beğendiğim ve beğenmediğim yönleri olsa da, genel olarak güzel bir filmdi. Beğendiğim yönleri, soğuk savaş atmosferini epey iyi vermişti bence film. Beğenmediğim yönüyse, Bobby Fischer'ın karanlık iç dünyası ve bu iç dünyanın çalkalantıları hakkında bize verilen bilginin yetersiz ve sığ olması. Şahsen A Beautiful Mind filmini bu konuda epey daha başarılı bulmuştum, Nash'in iç çatışmalarını yansıtması açısından. 

Nash ve eşinin de, mal bir taksici yüzünden New Jersey'de bir trafik kazasında ölmüş olması kadar da saçma bir şey yok herhalde.

Pazartesi, Ocak 11, 2016

Aramızdan ayrılan Major Tom'lar ya da RIP David Bowie

Hani geçenlerde David Bowie'nin doğum günüydü ya, takip ettiğim bütün sosyal medya oluşumları David Bowie diye delirmişti, zaten albüm de çıktı ona da biraz delirilmişti. Ben de Space Oddity 'nin sevdiğim bütün farklı versiyonlarını falan düşünüyordum, liste yapsam mı acaba diye. Bu sabah David Bowie'nin öldüğünü öğrendim (dünyanın geri kalanı gibi). RIP David Bowie. Şarkıların seninle olsun. Yıllar önce bir arkadaşımla konuşurken, Queen hakkında, onlar gibisi gelmedi bir daha, gelemez de zaten yeri doldurulamaz demişti. Sanırım aynı şeyi David Bowie için de söyleyebiliriz.
O zaman dün izlediğim filmde de geçen şu şarkıyı dinleyelim Bowie'den:
Modern Love

Filmlerle 2015

2015 yılında izlediğim filmlerin hepsini tabii ki hatırlamıyorum ama bakalım kaç tanesini buraya yazabileceğim:
  1.  Sicario 
  2. The Martian
  3.  Mad Max: Fury Road
  4.  Jurassic World
  5.  Avengers: Age of Ultron
  6. Mission Impossible: Rogue Nation
  7. The Man from U.N.C.L.E
  8. Ant-Man
  9. Spy (?)
  10. Ted 2
  11. San Andreas
  12. Pixels
  13. Focus (?)
  14. Star Wars: The Force Awakens
  15. The Interview
  16. The wedding Ringer
  17. Chappie
  18. Kill me three times
  19. Vacation
  20. American Ultra
  21. Man up
  22. Absolutely Anything
  23. Me and Earl and the Dying Girl (?)
  24. Dope
  25. Birdman
  26. Ex Machina
  27. The Final Girls
  28. Cooties
  29. Turbo Kid
  30. Trainwreck(?)
  31. Horrible Bosses 2 (?)
  32. Inside Out
  33. Kingsman: THe Secret Service
  34. The Hunger games: Mockingjay 2
  35. Predestination
  36. D-Train
  37. Cartel Land
  38. Spare Parts
  39. The Little Prince
  40. Two Night Stand
  41. Paddington
  42. The Imitation Game
  43. Into the Wild
  44. Irreversible
  45. Christmas Vacation
  46. National Lampoon's Vacation
  47. European Vacation
  48. Listening
  49. Asterix
  50. Cabin in the woods
  51. Searching for Sugar Man
  52. Encounters at the end of the world
  53. The Darjeeling Limited
  54. The Broken Circle
Aklıma gelen filmler şimdilik bunlar, hatırladıkça ekleri ve vakit buldukça filmler hakkında düşündüklerimi yazarım. Arada alıntılar yapmak istediğim, fikirlerimi yazmak istediğim filmler var. Yanında soru işareti olan filmleri bitirmemiş olabilirim, muhtemelen tekrar izlemem falan gerekiyordur hatırlamak için. Onun haricinde, mesela Ex Machina'yı tekrar izlemek isterim çünkü tam olarak hatırlamıyorum şu anda.

Tiroid kafası bambaşka bir şey ya, yazdan hatırlamadığım o kadar çok şey var ki... Bana kalsa bunun en azından iki katı film izlemişim/ izlemişizdir.


Dizilerle 2015

Şimdi de sırada diziler:

  1. Jessica Jones
  2. Daredevil
  3. Mr Robot
  4. Narcos
  5. The Brink
  6. Humans
  7. 12 Monkeys
Sanırım 2015'te başlayan ve izlediğim diziler bunlar. Yani 2015 öncesinde zaten izlemekte olduğum ve deva ettiğim dizileri buraya yazmadım. Ama daha önce başlamış olmasına rağmen benim 2015'te izlemeye başladığım diziler de var. Mesela:
  1. The Brain With Dr. David Eagleman
  2. Brain Games   

Bu iki dizi de sinir bilimle alakalı. İlkini labdan biri tavsiye etmişti, ancak ben biraz sıkıcı buldum, bilmediğim ve bana eğlenceli gelen pek bir şey bulamadım dizide. Bunu öneren insan doktorasının başında sayıldığından ona ilginç geliyordur belki. İkincisi daha eğlenceli. Bol bol görsel ilüzyon var, çoğunu bilsem de eğlencesini kaçırmıyor bu benim için, görsel ilüzyonlar her zmaan eğlenceli bence.

Diziler hakkındaki düşüncelerimi ve unuttuğum diziler varsa devamını sonra eklemeye karar verdim.

2016 izlenen filmler vol#1

Merhaba,
kısa kısa film günlüğü tutmam gerektiğine karar verdim çünkü aksi durumda izlediğim şeyleri hatırlamaz oldum resmen.
Bakalım yılbaşından beri neler izlemişim:
Bugün Everest 'i izledik. Film 1996'da yaşanan gerçek olaylara dayanıyor. İnsanoğlunun doğaya karşı kibirli ve hırslı davranması ne zaman iyi sonuçlandı ki zaten. Güzel filmdi, en ufak bir hatanın ölü demek olduğu yerde insanların yaptıkları mantık dışı hataları görmek ibretlik diyeceğim de, sanki ben olsam hata yapmayacak mıydım? Büyük ihtimalle çok daha salakça hatalar yapardım.

Bugün bir de Sleeping with other people adlı filmi izledik. Film eğlenceli, sevdiğim oyuncuları kapsayan, hafif bir romantik komedi. Güzeldi ve aslında günceldi. Ama sanırım son zamanlarda çekilen romantik komedilerin çoğu bir açıdan benzer, biz öylesine takılırken aşık olmuşuz birbirimize.  Ana kahramanlarımız üniversitede ilk kez birbirleriyle seks yapıyorlar. Bundan 12 yıl sonra sekskolikler toplantısında karşılaşıyorlar. Sonra işin içine hiç seks karıştırmadan birbirleriyle arkadaş olmaya çalışıyorlar, ve aslında kendilerini sevmeyi öğreniyorlar.

Geçenlerde Mistress America 'yı izledim. Son zamanlarda izlediğim en güzel filmlerden biri. Neden? Bağımsız sinema, başkahramanları kadın, şehir hayatının koşuşturmasını ve şehirli insanın bir bok olamazken her bok olmaya çalışmasını anlatıyor. Burada şehirden kastımız New York tabii ki. Kahramanımız Tracy, taşralı bir kızcağız. Üniversite okumaya New York'a geliyor. İşler pek istediği gibi gitmiyor, ortamlara giremiyor falan. Tracy, okulun en cool öğrenci topluluğu olan edebiyat dergisine girmeye çalışıyor ancak öyküsü kabul almıyor. Bu sırada annesi, bir adamla evlenmek üzere ve Tracy'e evleneceği adamın kızının da New York'ta yaşadığını, onu aramasını söylüyor. Tracy ilk başta mal mıyım anne 30 yaşında kadın işi gücü vardır beni ne yapsın dese de sonunda yalnızlığına yenik düşüp arıyor. Böylece filmimize diğer kahramanımız Brooke dahil oluyor. Brooke çılgın, deli dolu, bir anı diğerine uymayan, şu ne iş yaptığı belirsiz ama her işi yapan, herkesi tanıyan şehirlilerden. Tracy, Brooke'u konu eden bir öykü daha yazmaya başlıyor ve olaylar böyle gelişiyor.

Spoiler vermemek de önemli tabii.

Ondan bir kaç gün önce People Places Things diye bir film izledim. Yine şahane bir filmdi. Yine bağımsızdı. Bana biraz Louie'yi hatırlattı çünkü buradaki kahramanımız da eşinden ayrılıp iki kız çocuğuyla zaman geçirmeyi öğrenmeye çalışıyor. Çocuklar çok şirindiler. Kahramanımız Will Henry, kızlarının beşinci doğum gününde eşi tarafından terk ediliyor.Bir okulda ders veren kahramanımız bir yandan da karikatür sanatçısı. Yeni insanlarla tanışma, evliliğinin bitmesini kabullenme, çocuklarıyla dengeli ve sorumluluk sahibi bir ilişki içinde olma gibi konularda kendini geliştirmesi üzerine bu film aslında.
Bazı alıntılar var filmde, çok iyi bence. Bir öğrencisi iyi misiniz diye soruyor, cevap olarak iyiyim sadece kötü bir hayat geçiriyorum, geçer diyor. Bir de adam mutluluk sürdürülebilir bir durum değil diyor ki, duvarlara yazılası bir cümle bence.

Böyle işte, güzel filmler güzel pizza gibi, mutluluk kaynağı. Daha film izledim mi hatırlamıyorum ama aklıma gelirse eklerim.


Pazar, Ocak 10, 2016

Kitaplarla 2015

Bu postu biraz gecikmeli giriyorum sanki, evet. Farkındayım. Hatırlatmasan da olur sevgili okur. Ama aklımdaydı, yine aklımda yazıp çizip durdum. 
Neyse, goodreads sağ olsun, bir yıl içinde ne kadar okumuşum, ya da daha doğrusu okumamışım gözüme soktu iyice. 2015'te toplam sadece 10 kitap okumuşum (bitirebilmişim yani). Bakalım neler okumuşum:
1. Yılın ilk ayı, elimde sürünen On the Road'u (Jack Kerouac)  bitirmişim.
File:OnTheRoad.jpg
Dürüst olmak gerekirse, bu kitap okumayı çok istememe rağmen elimde epeyce süründü, nedense filmin verdiği büyülü tadı vermedi bana. Belki benim ruh halimdendir, bir yerden sonra yaptıkları şey beat kuşağı hareketleri olmaktan çok sefillik çeken insanlar oldu gözümde. 

2. Bir sonraki kitabın bir de hikayesi var. İzmir Çeşme otobüsünde, benimle aynı hizadaki koltuklarda oturan Amerikalı bir çifte, muavinin ingilizce bilmemesi üzerine yardımcı olmuştum. Adamla konuşmaya başladık, kızı da sinir bilimi üzerine çalışıyormuş, sanırım adam da bilişsel bilim ya da sinir bilim üstüne akademisyendi. Elinde okuduğu kitabı önermişti, ben de okudum. Kitabımızın adı Superintelligence: Paths, Dangers, Strategies (Nick Bostrom).


Bu kitap da biraz hayal kırıklığıydı. Konusu epey ilgi çekici olmasına rağmen, yazarın stili için aynı şeyi söyleyemeyeceğim. Lafı epey dolandırmış, gerek sözcük seçiminin tatminkar olmaması, gerekse akıcı olmaması açısından bende umduğum tadı bırakmadı.

3. Daha sonra Albert Camus'dan Düşüş'ü okumuşum. 

La Chute.jpg
Bu kitap ise her Camus kitabı gibi insanlığın boktanlığını bütün gerçekçiliğiyle yüzümüze vuruyor. İnsanların iyi insan olmak için yaptıkları her şeyin aslında kendi bencilliklerinin ürünü olduğunu gözümüze soka soka anlatıyor. İnsanlık hakkında Camus kadar karamsar mıyım (ya da realist miyim de diyebiliriz belki burada) bilmiyorum ama kesinlikle okunması gereken bir kitap bence.

4. Sonrasında Elif Şafak'ın Aşk imiş okuduğum kitap. onun da hikayesi var, burada benden eski bir doktora öğrencisi olan ve 2 buçuk yıl önce kadar bitirip Türkiye'ye dönen bir arkadaşım vermişti, ben okudum istersen oku diye. Sonra giderken kitabın bende vereyim mi demiştim, dert değil kalsın sende demişti. Havuza giderken Kindle götürmek istemediğimden aman şunu alayım güneşlenirken okurum diye götürmüştüm. 

Aşk Kapak.jpg












Kitap oldukça sürükleyici, bir hafta sonunda bitti hatta. O açıdan yaz tatili / güneşlenme kitabı gibi kafalara uygun. Yalnız Elif Şafak ve Orhan Pamuk, bana hep aynı tadı veriyorlar. Batılı oryantalist gözüyle yazılmış özenti kitapların yazarları.  Her ikisini de oldum olası pek bir özenti bulmuşumdur zaten. Ama genelde ikisinin de kitapları sürükleyici oluyor. Sadece bana kattığı bir değer var mıdır sorusunun cevabı bence karışık. Neyse, her şeyi işe yaraması için yapmak zorunda değiliz, değil mi?

5. Sonra, sanırım hastayken evde bulduğum kitapları, bilgisayarımda bulduğum pdf kitapları falan okumaya başladım (hala çoğu zaman elektronik kitap okuyorum gerçi). Peyami Safa'nın Dokuzuncu Hariciye Koğuşu'nu okudum. Yıllar önce Peyami Safa hakkında bir ödev hazırladığımdan dolayı, Peyami Safa kitaplarının çoğunu okumuştum. Bu eksik kalmıştı sanırım. Şimdi bunu da okudum.

Dokuzuncu Hariciye Koğuşu.jpg










Bu kitabın özelliği, yanlış hatırlamıyorsam Peyami Safa'nın hayatı hakkında otobiyografik öğeler içermesiydi. Kitap güzeldi, kötüydü bir şey diyemeyeceğim .çünkü bence bu dönem kitaplarının kendi içinde değerlendirilmesi gerekiyor.Yani modern Türkçe edebiyatın gelişimi konusunda bir merakınız varsa Peyami Safa'nın diğer kitapları gibi okunası bir kitap.


6. Bir sonraki okuduğum kitap ise Sahilde Kafka (Haruki .Narukami). 


sahilde-kafka-haruki-murakami

15 yaşına girdiği gün evden kaçan Kafka Tamura'nın büyülü öyküsü. Marukami'nin okuduğum ilk ve şimdilik tek kitabı. İçinde çok güzel metaforlar, göndermeler var. İç içe pek çok hikayeyi, ip yumağı haline getirmeden, ustaca, ama akıcı ve heyecan verici şekilde, bence çok güzel anlatıyor. SAnırım 2015 benim Fantastik edebiyata farklı bir açıdan bakmaya başladığım yıl olarak anımsanacak (tarafımdan). 


7. Sonrasında İhsan Oktay Anar'dan Galiz Kahraman'ı okudum. Bu kitabı ilk çıktığında çok merak etmiştim, Türkiye'ye gitsem de alsam diye düşünmüş, sonra başlamış ama bitirememiştim (2014 yılında). 2015'te bitirdim (baştan okudum demek daha doğru olur sanırım)
Kapak resmi












Kitap bence İhsan Oktay Anar'ın diğer kitapları kadar başarılı değil. Yani o büyülü havayı nedense veremedi bana.  

8. Daha sonra Oliver Sacks'in Karısını Şapka Sanan Adam'ını okudum. Sacks, bu yıl kanserden öldü maalesef ve bu en ünlü eseriydi pek çoklarına göre. Günümüzdeki genç sinir bilimcilerinin çoğuna ilham vermiş bir kitaptan bahsediyoruz. Sacks'in hastalarından bahsettiği kısa öykülerden oluşuyor kitap. Nöroloji hastaları, bilinç, beyin ve biliş üzerine muhteşem gözlemler ve hikayeler bunlar.

Karısını Şapka Sanan Adam













Bence bu da kesinlikle okunması gereken kitaplardan. İnsan beyninde yeni yolculuklara çıkmak için çok güzel bir bahane.

9 & 10. Bir sonraki durağımız ise Ursula K. LeGuin. Yıllar sonra K. LeGuin okumak apayrı bir heyecan. Yerdeniz Üçlemesinin ilk iki kitabını okudum: Yerdeniz Büyücüsü ve Atuan Mezarları.


Yerdeniz Büyücüsü - Yerdeniz 1Atuan Mezarları - Yerdeniz 2


Yıllar önce Yerdeniz Büyücüsü'nü okumayı denemiştim sanırım ama olmamıştı. Dedim ya, 2015 Fantastik edebiyat yılı oldu benim açımdan diye. Yılın en sevdiğim kitapları bunlar oldu, devamını da okuyorum hatta serinin. İlk kitap çocukluk ve büyümek üzerine, ikinci kitap ise bence daha ziyade ergenlik, büyümek ve kadınlık üzerine. LeGuin'in kadın kahramanlarını ayrı bir seviyoruz efendim. 

Şu anda ikisi teknik, biri popüler bilim diğeri de Yerdeniz serisinin üçüncü kitabı olmak üzere pek çok kitap okuyorum. Okunacaklar listem de epey uzun. Umuyorum geçen yılki kadar vasat bir yıl olmayacak 2016, umuyorum ki daha çok kitap okumayı başaracağım. Ve daha çok yazmayı ve üretmeyi de. Bu postu filmler diziler listeleri de izleyecek büyük ihtimalle. Görüşmek dileğiyle :)



Cumartesi, Ekim 03, 2015

31

Epey oldu yazmayalı, o zaman en başından hepsini anlatacağım, tamam.
Ağustos'un sonlarına doğru doğumgünümdü, 31 yaşımı doldurdum artık, eşşek kadar kadın oldum evet. Resmi olarak otuzlu bir şeylerde olduğumuza göre genç yetişkin sayılıyorduk, yaşlanıyorduk falan.
Bir yıl önce, 30 yaşımı doldurduğumda önce kapitalist ana akım medyanın dayatmasıyla bir panik kapladı içimi. Yaşlanıyordum, ne istiyordum hayattan, daha onu bile bilmiyordum. Tek derdim modern zamanların en overrated  dileği olan mutluluktu, gerçekten mutlu muydum, onu düşünüp irdelemekten nasıl mutlu olunacağını bilmiyordum. Bugün ölsem yaşadığım hayattan ne kadar pişmanlık duyarım diye düşünüyordum. Biraz depresiftim anlayacağınız, büyük ihtimalle epey hırslı insanlarla dolu bir ortamda akademisyen olmaya çabaladığımdan dolayı da stresliy(d)im.
Sonra, doğum günüm vesilesiyle, artık yaşam kaliteme yatırım yapmam gerektiğine karar verdim ve bir yoga stüdyosuna kaydoldum. İlk başta çok sık gitmedim, ama ekimde stüdyoya sınırsız abonelik almaya karar verdim ve haftada 3 gün gitmeye başladım. Haftada 3 gün yogaya gidiyor, hemen her gün az da olsa koşuyordum. Mutluydum, sonunda kendim için iyi bir şeyler yapıyordum. Herkes grip olurken, benim vücudum hiç olmayacağı kadar iyi bir bağışıklık savunması yapıyordu. Şaşırtıcıydı ama bu kadar çabuk ödüllendirilmek güzeldi.
Sonra...
Sonra Kasım ayının ortalarında biraz nezle oldum önce. Sonra da midemde kötü bir ağrı başladı, sanki birisi midemi bıçaklıyormuş gibi. Bu günlerde bir kaç salaklık yaptım mı? Evet, tabii ki. Mal gibi bir kaç kez ibuprofen içtim. Almanların ibuprofeni leblebi gibi tüketmesi sebebiyle olsa gerek, NSAID ağrı kesicilerin benimki gibi zaten sıçarlı midelere ne kadar kötü gelebileceğini unutmuşum. Ama doktorların hiçbiri falan bu konuyla ilgilenmediğine göre, belki ondan değildir. Neyse. Midem zaten çocukluğumdan beri hassastı da, ben de pek iyi davranmamıştım kendisine. Yıllardır gittikçe kötüleşen reflüm vardı. Ve ben bunun için doktora bile gitmemiştim, öyle de ihmalkarım. Reflüm, su içsem yanıyor mertebesine vardığında buradaki içme suyuna bok attım tabii ki, yine doktora gitmek yerine.
Neyse efendim, konumuza dönersek, mideme bıçaklar batıyor, yutkunurken büyük zorluklar çekiyordum. Ve tam olarak başladığı günü hatırlıyorum.. Sinemaya gitmiştik ve bütün gün bok gibi beslenmiştim evet. Neyse, önce umursamadım ama, iki gün sonra mecburen kahveyi bıraktım çünkü kusacak kadar rahatsızlık ve ağrı veriyordu. Kahve içemeyince, bağımlılık sebebiyle gelen baş ağrısı bir hafta sürdü sayın okur. Ve ben bunların hiçbiri sırasında doktora gitmedim. Mide ağrılarım bir hafta- on gün sonra biraz katlanılır düzeye geldi, ben de önemsemedim. Ama kısa bir süre sonra tekrar kötüleşti, ben de doktora gitmeye karar verdim sonunda. Evime en yakın aile hekimliği ofisinde 4 doktor var. Biz daha önce B. ile gittiğimizde onunla ilgilenen doktor yoktu, bu sefer başka bir doktor ilgilendi. Deneyimli bir doktordu, ingilizcesi de iyiydi, fakat et yemediğim için hakaretvari bir tutuma girmiş olmasından pek hoşlanmadım. Ama yine de hekimlik kısmına geri dönersek, midemde gastrit olduğunu, ve yıllardır reflü sorunum olduğunu göz önüne alınca yutkunma sorunlarımı ciddiye almam gerektiğini söyleyerek iki çeşit ilaç ve endoskopi ( gastroskopi) için sevk verdi. Bir sürü de kan tahlili yapıldı, uzun lafın kısası, demir eksikliği ve ciddi D vitamini eksikliği çekiyormuşum. Bu doktorla yollarımı ayırma isteğim, verdiği ilaçlardan birinin sebep olduğu yan etkiler ve başka mide bağırsak şikayetleriyle gititğimde beni dinlemeyerek psikosomatik diye geçiştirmesi oldu. Aynı doktor ofisinde deneyimli olan başka bir doktora denk geldim bir dahaki gidişimde, ve o adam da bu yan etkilerin özellikle genç kadınlarda çok görüldüğünü ve bu ilacı niye kullandığımı bile anlamadığını belirterek kesmemi söyledi (Gastroentereloji uzmanı da benzer şeyleri söyledi daha sonra).
Bu arada sürekli kontrolden geçmem ve doz ayarlaması gibi şeyler yapılması gerekiyordu. Sanıyorum bu arada bir zamanda, o doktor ofisindeki bütün doktorlarla muhabbetim olduktan sonra şimdiki doktorumla denk geldim (daha önce B ile ilgilenen ve hoşlandığımız doktor). Diğerlerinden daha az deneyimli ancak a) İngilizcesi iyi, benim almancam ve onun ingilizcesiyle epey anlaşabiliyoruz b) DİNLİYOR. Bence bir doktorda olması gereken en önemli özellik bu.
Neyse, endeskopi yapıldı, oradaki doktor da açıkçası sindirim sorunlarımın bir kısmını görmezden geldi, yemek yerken konuşma, daha çok çiğne gibi mükemmel tavsiyelerde bulundu. Sonuç olarak Helicobakter Pylorii teşhisi kondu. Bunun yanında, endoskopi sonuçlarımda daha başka bulgular da vardı ama Helicobakter ve buna bağlı gastrit sebebiyle diğerlerinin üstünde durmadılar, es geçtiler. Mesela, oniki parmak bağırsağımdaki bulgular, çölyakı da işaret edebilecek şekilde, ancak çölyaka özgü olmayan  bazı farklılıklar içeriyordu, bu bulgular önemli ya da anlamlı değildi, ancak tamamen sağlıklı da değildi. Benim doktorum belki glutensiz beslenebileceğimi söylemişti, ancak gastroenteroloji uzmanına danıştığında çok büyük ihtimalle onunla alakalı değildir cevabını aldı, biz de vazgeçtik. Helicobakter için üçlü eradikasyon terapisine başladık, bu terapi iki ağır antibiyotik ve zaten aylardır kullandığım proton pompasi inhibitörü ilacın arttırılmış dozunu içeriyordu. Ağzıma sıçtı bu bir hafta, ağzıma gelen ilaç tadından falan uyuyamadım. Genelde pek çok ilacın yan etkisine müsait bir bünyem var, söylemiş miydim?
Neyse, bundan sonra iki hafta prebiyotik kullandım doktorun önerisiyle, bu arada D vitamini eksikliğini bu esnalarda farkettik ( kan tahlillerini diğer doktor yaptırmıştı ama bana söylerken gözden kaçırmışlar, ben de tahlil sonuçlarını aldığımda orada gördüğüm saptanamadı yazısını teknik bir sorun olarak algılamıştım). D vitamini kullanmaya başladım, haftada bir tablet alıp 8 hafta kadar sonra kontrole gidecektim.
Bu esnada midem epey düzeldi gibi oldu, proton pompası inhibitörünü de bıraktım. Açıkcası aylar sonra ilaçları bırakmıştım ve doyacağım kadar yemek yiyebiliyordum! Yapmam gereken işlerle ilgili çok gerideydim ve çok yoğundum, deneylerimi tamamlamamı bekleyen yeni bir master öğrencisi vardı ve ben makalemin düzeltmelerini bitirmek, geciktirdiğim tez kurulu toplantımı gerçekleştirmek, deney sonuçlarımı analiz edip konferans bildirisi yazmak, deneylerimi tamamlamak gibi şeylerle çok mesguldum. Doktora tekrar gitmem 4-5 ayı buldu, gittiğimde doktorum yoktu, sonra gitmek üzere çıktım. Bu 4-5 ay içinde, şimdi düşününce bir sürü şey olmuş ama ben hepsini strese ve mideme bağlamışım. Mideme kramplar giriyor, şarıl şarıl terliyordum. Bir de Almanya bu yaz en sıcak yazını yaşadı ben buraya geldiğimden beri. Uyuyamıyordum, sıcaktan olduğunu düşünüyordum. Doktora gitmeyi denedikten sonraki hafta halam, eniştem ve kuzenim geldiler, 5 gün birlikte epey sıkı bir gezi planı yapmıştık. Çok sıcaktı. Ben kilo veriyordum, çok mutluydum. Gezmekten kilo verdiğime inanmıştım saf gibi. Bir de sürekli olarak ishal oluyordum (Aşırı bilgi farkındayım ama söz hepsi  bağlantılı). Misafirlerim gittikten sonra doktora gittim. Doktora asıl gitme sebebim, 6 ay sonra tekrar endoskopi yapacağız Helikobakter için demişlerdi. Dedim böyle böyle demiştiniz, hem de D vitamini için tekrar tahlil yapacaktınız, bir de ben ishal oluyorum sık sık, bana intolerans testi yaptırır mısınız? Aa dedi doktor, sana laktoz ve fruktoz testi yaptırmamış mıydık? Yaptıralım onları. Laktoz, fruktoz, helikobakter için daha önce gittiğim doktora sevk yazdı. Kan tahlili sonuçlarımı da ertesi gün almaya gittim. Asistan kızlardan pek ingilizce bilmeyeni vardı, yanında da benim doktorum değil ama deneyimli doktorlardan biri vardı. Kız tahlili doktora gösterdi, doktor tiroid rahatsızlığının kontrolü için mi geldin dedi, benim surat şok. Yoo dedim, sonra adam sormaya başladı, saçın dökülüyor mu, kilo veriyor musun vs vs. Dedikleri o anda anlamsız gelse de sonradan üstünde düşününce hepsinin cevabı evet idi. Böylece, bir doktor ofisinin danışma masasında, alenen, tiroit rahatsızlığım olabileceğini öğrendim. Hemen labı arayıp ellerindeki kan üstünde 2 test daha yapmasını söylediler. Bana da iki gün sonra gelmemi söyledi doktor. Ha bir de kansızlık vardı ama olsundu, açıkçası şu durumda hç umursamamıştı.
 İki gün sonra kendi doktoruma gittim, evet TSH (tiroit stimule edici hormon) seviyem çok düşüktü, serbest T4'üme bakılmıştı (tiroid hormonu), o da yüksekti. Hipertiroidden muzdariptim. İki doktora da bilmemkaç kere ailemde epey çok otoimmun hastalık olduğunu, hepsinin bağlantılı olduğunu bildiğimi, üstelik ablamda Hashimoto olduğunu söyledim. Doktorum hemen o gün tekrar kan alıp 2 ayrı antikora (antibody) baktırdı. Birisi Graves hastalığı, diğeri Hashimoto hastalıgında en sık görülen antikorlardı bunlar. İki gün sonra  gittiğimde iki antikor da normal sınırlar içinde çıkmıştı, thyroiditis olduğunu düşünüyordu ama teşhis konamamıştı, önemli değildi çünkü şu anda hipertiroid idim ve semptomlar da olduğundan ilaç tedavisine başladık. İlk hafta 20 mg Carbimazole kullandım. Kafamı yataktan kaldıramıyordum. Bir hafta sonra tekrar kan tahlili yaptırmaya gittiğimde doktora bunu söyledim, kan tahlili sonuçlarını beklemeden günde 10 mg'a düşürdük. Kan tahlili sonuçlarımı alamadan haftasonu için arkadaş görmeye Amsterdam'a gittim. Ha bu arada, fruktozla sorunum yoktu ama ciddi laktoz intoleransım vardı. Laktaz enzimi de aldım yanıma. Pek güzel bir gezi olmadı, başka sebeplerin yanı sıra, yemek konusu epey sıkıntılıydı, benim sürekli çarpıntım vardı ve huzursuzdum. Uyuyamıyordum da. Neyse, pazartesi sabahı evdeydik. Bir sonraki kan tahliline gittiğimde doktora ben epey kötüyüm dedim, nabzıma baktı, kalbimi dinledi falan, bunları ilk teşhis koyduğunda da yapmıştı ve iki hafta içinde ne kadar kötüye gitmiş olduğuna şaşırdı. Üstelik bir hafta önceki tahlil sonuçlarıma baktık ve ilaç kullanmama rağmen bir haftada ikiye katlanmıştı tiroid hormonlarım. Doktorumu hafiften bir endişe sardı, görebiliyordum. Ne yapacağımızı bilmiyorduk. Çarpıntım için beta bloker verdi. Tiroid konusunda uzman bir doktoru aradı ( doktorumu bu yüzden de seviyorum, ben her şeyi bilirimci değil, gerekiyorsa başkalarına danışmaktan çekinmiyor).  Ertesi gün tiroidlerde tümör / nodül vb olabileceği şüphesiyle dğer doktora gittim ve ultrason yaptı, bir şey çıkmadı. Tiroid bezlerimde enflamasyon görünüyordu sadece. Bu diğer doktor iç hastalıkları- nükleer radyoloji alanlarında uzman. İki doktor da bana bir kaç kez çok gençsin dedi, ki sanırım bu hikayenin kalanı için kilit kelime oldu. Bu adam, alanında iyi bir doktor olmakla birlikte sanırım yaşının da verdiği etkiyle ezber bozan şeyleri dinlemiyor, sadece klasik hastalık seyriyle ilgileniyor. İlacımın dozunu 40 mg'a yükselttiler.
40 mg Carbimazole ve beta blokerler işe yarıyordu. Çarpıntı falan azalmıştı. Bir kaç sabah yataktan kalkıp 110'un üstünde nabız görünce insan ufaktan panikliyor. Hava aşırı sıcaktı ve lanet olasıca hipertiroid sıcağa tahammülsüzlük yapıyordu. Biraz daha kilo vermiştim ve kendimden utanacağım kadar çok terliyor, terden uyuyamıyordum. Genel olarak uyuyamıyordum. Biraz nevrotik/ manik haldeydim açıkçası. Her şeyi yapmak istiyordum ama bir yandan da sürekli yorgundum.
Bu arada süpervizörümün ve cevremdeki insanlarin onemli bir kisminin ne kadar anlayışsız olduğu konusuna girmek istemiyorum. Herkeste var lafından bu süre içinde ne kadar nefret ettiğimi de anlatamam. Insanların o kadar aptalca tepkileri oldu ki.
Neyse, 40 mg'a başladıktan yaklaşık 3 gün sonra kaşınmaya başladım. İlk başlarda abartılacak bir şey yoktu, ama kaşıntının yan etki olabileceğini hem doktorum söylemişti, hem de ben okumuştum. Sorun şu ki, hipertiroid, özellikle de genç hastada, pek ender görülüyordu ve anladığım kadarıyla gittiğim hiçbir doktorun bu konuda deneyimi yoktu. Zaten eczaneden ilaç alırken de depodan getirtmeleri gerekiyordu, o kadar seyrek ihtiyaç duyuyorlardı. Neyse, 40 mg'a başladıktan bir hafta sonra kontrole gittiğimde doktora kaşındığımı söyledim, o da başka bir çeşit daha ilaç olduğunu, mecbur kalırsak ona geçebileceğimizi söyledi. Ben de kötüleşirse tahlil sonuçlarını almaya geldiğimde konuşuruz dedim.
Şimdi, asıl şanssızlığım bu noktadan sonra başlıyor. Cuma akşamı tahlil sonuçlarımı almaya gititm, benim doktorum yoktu, üstelik önümüzdeki 3 hafta izinliydi. Ayrıca bu doktor ofisi bir sonraki hafta kapalıydı (günde bir saat sadece acil şeyler için açık olacaktı). Tahlil sonuçlarımı alıp çıktım, tiroid hormonlarım epey hızla düşüyordu, hala normal değerlerden yüksekti ama. Ben ilacı 40 mg kullanmaya ve kaşınmaya devam ettim, deri döküntüleri başlamıştı, antihistamin alıyordum,  biraz iyi gelmişti ama avuçlarımda çok kötü enflamasyonlu bir döküntü olmuştu, kıpkırmızı, ortası beyaz, ağrılı ve yanma hissiyle dolu kabarcıklar, inanılmaz da kaşınıyordu. sabrımı zorladım, ertesi cuma tiroid ultrasonumu yapan uzman doktora gittim, ilaçtan değildir, sadece ellerinde olmaz vs vs diye  biraz başından savdı beni, 40 mg kullanmaya da devam etmemi söyledi. Kalan cilt döküntülerim konusunda da anlaşamadık.
O haftasonu hayatımın en kötü deri döküntüsünü yaşadım, ki 17 yıldır türlü çeşit egzama ile falan uğraşan bir insanım. Bütün haftasonum, bütün vücudumu saran ürtikerle geçti, boğazım şişerse hemen acile gitmem lazım diye bir ruh haliyle oturup pazartesiyi bekledim. Bu esnada salak gibi hapları HALA bırakmamıştım. Pazartesi doktora gittim, benim doktorum yoktu, o ofiste en az ingilizce bilen doktora denk geldim, belli ki benim ilacım konusunda da deneyimsizdi, bana yüksek doz kortizon verdi , ilaçtan olduğunu sanmıyorum ama üç gün bırak dedi, ayrıca kaşıntılarım geçmezse, gerekirse max üç gün alayım diye kortizon hapı verdi, kan tahlili falan yapmadan gönderdi beni, zaten bu kadar sık tahlil yaptırmama da gerek yokmuşmuş (düşündükçe sinirlenen ısırganotu). Üç gün hapı bıraktım, o yüksek doz kortizon da biraz iyi geldi. Bu doktora gittiğim gün doğum günümdü işte. Akşama da evde pizza ve cheesecake yemek istedim, istemesem daha iyiydi. Çünkü daha sonra anlayacağımız üzere, laktaz enzimi haplarıyla bünyem uyuşmuyordu, sık rastlanmasa da kimi insanda olurmuş böyle şeyler. Bütün bunlar olurken, laktaz enzimini bir kaç kere kullandım ve her seferinde daha kötü bir macerayla bitti. Kramplar, sokağın ortasında kusmalar, evde sabaha kadar kusmalar falan.
Neyse, 3 gün sonra Carbimazole'a tekrar başladığımda yine kabardım. Bıraktım, ama geçmedi kabartılar. ellerim ve ayaklarımın altı korkunçtu. Psikolojim bozulmuştu, haftalardır ürtikerle uğraşıyordum ve doktorlar beni anlamıyordu, kendi doktorum da yoktu. bir hafta kadar sonra bir önceki sefer kortizon veren doktora bir daha gittim (kendi doktorum hala izindeydi). Belli ki, geçen sefer ben gittikten sonra içine sinmemiş bu konuyu okumuştu. İlacı bırakmam gerektiğini, büyük ihtimalle ilaçtan olduğunu, bir süre daha ilacın etkisi yüzünden kasintilarin devam edebileceğini söyledi ( Bu arada, İngiltere'de, bu ilacı kullandığınızda bir buçuk yıl süreyle kan veremeyeceğinizi çünkü ilacın vücuttan atılmasının o kadar sürebileceğini, sizin kanınızı hamile bir kadında kullanırlarsa istemeden bebeğe zarar verebilecekleri için böyle bir önlem aldıklarını biliyor muydunuz?). Bu esnada vicdan azabıyla tam kan testi yaptı ve bir hafta sonra gelmemi söyledi (niye bir hafta bekliyoruz bu da ayrı bir konu). Bir hafta sonra kendi doktoruma gittim. Sonunda dönmüştü, çok mutluydum! Bütün bunlar olurken hayata karşı isteğim kalmamıştı, kafamı kaldıramıyordum, işe gitmek falan istemiyordum, paso uyumak istiyordum, hiç halim yoktu, kimseyle görüşmek istemiyordum, bütün hayatım bu hisle geçecek sanıyordum. Ancak ilacı bıraktıktan bir süre sonra farklı bir şey oldu, uyku problemleri tekrar basladi, geceleri uyanırsam yine uyuyamıyordum, ama bütün gün çok ama çok yorgundum, kafamı hiçbir şeye veremiyor, geri zekalı gibi hissediyordum. Bana kalsa bilişsel fonksiyonlarımda kayıp yaşıyordum! Müthiş de bir anksiyete başlamıştı, ya bundan sonra böyleysem, nasıl iş bulacaktım? Ne yapacaktım ben? Geceleri uyanıp böyle şeyleri kafaya takıp uyuyamıyordum.
Neyse uzun lafın kısası, doktorumla kan tahlili sonuçlarıma baktığımızda bu sefer hipotiroid olduğumu farkettik . Böyle kısa sürede böyle delicesine değişimler! İnanılır gibi değildi. Ben böyle şey görmedim dedi. Diğer uzmanı aradık, hala ilaçtan olabileceğini söyledi. Tekrar kan tahlili yapıldı, bir kaç gün sonra tekrar gittim. Tiroid hormonlarım daha da düşüktü. Bu sefer başka bir antikor bakmaya karar verdiler kanda. Ve hipotiroid semptomlarım olduğu için sentetik tiroid hormonuna başladım.
Özet geçecek olursak, Haşimoto (Hashimoto's Thyroiditis) hastalığı teşhisi kondu. Hoş bende sadece  tek bir antikor,Tgab olduğundan, ve Tgab hem Hashimoto hem de Graves otommünitesinde görülebildiğinden, iki yıl sonra teşhis değiştirirsek şaşırmam.
Ama sonunda bir teşhis olduğu için doktorla yaşadığımız o rahatlamayı anlatamam. Yani o kadar saçma bir durumdayım ki, doktorum bir kaç kez ne yapalım diye bana sordu, ya da mesela kan tahlili sonuçlarıma bakıp iyi değil ama (öncekine göre) daha iyi diyerek sevinmişliğimiz var.
Şimdiye kadar sürekli semptom tedavi ediyoruz, kaynak ne diye deliriyordum, sürekli yeni bir şeyler çıkıyordu ve biz sebebini de, nereye gititğini de bilmiyorduk.
Doktorla konuşmadan önce  glutensiz diyet denemeye karar vermiştim ve başlamıştım. Ben hiçbir şey demeden eski tahlil sonuçlarımı tekrar açıp, ben senin yerinde olsam Çölyak hastasıymışım gibi, glutensiz yaşardım dedi (Çölyak ve otoimmün tiroid hastalıkları arasında -özellikle Haşhimoto arasında- kuvvetli bir bağ var, birinin olması diğerinin görülme riskini epey arttırıyor). Şu anda glutensiz, mümkün olduğunca laktozsuz (nadiren yoğurt yiyebiliyorum)- süt ürünlerisiz ve tercih sebebiyle etsiz- balıksız bir diyet sürüyorum. Veganlık biraz zor, çünkü bu siralar yumurta ve bal tüketiyorum, yediklerimi oturttuktan sonra belki onları da azaltırım (sonuçta ikisi de alerji yapabilen yiyecekler zaten, çok zorlamaya gerek yok). Tiroid sebebiyle soya ürünleri tüketmemem gerekiyor (zaten mide sorunlarımdan sonra tüketmemeye başlamıştım). İyotlu ürünler de uzak durulacak şeyler listesinde. Glutensiz beslenmenin de demir eksikliği, anemi, mide sorunları gibi sorunlarıma çözüm bulabileceğini düşünüyoruz doktorumla. Belki de gerçekten dediği gibi her şeyin kaynağına inmişizdir bu sefer, becermişizdir.
Ek olarak, bir sürü başka hastalık riski de beraber geldiğinden, bundan sonra epey dikkatli olmam, iyi beslenmem falan lazım zaten.  Bu arada helicobakter de kalmamış.
Ha o verilen kilolar geri alındı tabii ki, bir de hipotiroid de soğuk havaya intolerans yapıyor, yazın sıcağında sıcak havaya kış gelirken soğuk havaya, süper değil mi?
Neyse, yeni bir beslenme düzeni keşiflerimi bekliyor!

TLDR (Çok uzundu okuyamadık durumumuz yoktu diyenlere gelsin): Yaklaşık bir senedir türlü çeşit sağlık sorunlarıyla uğraştıktan sonra sonunda bir teşhis kondu: Hashimoto hastalığı. Kendisi otoimmün bir tiroid hastalığı. Ömür boyu benimle artık. Şimdi biraz daha iyiyim, ve teşhis konduğu için rahatladım. Muhtemel çölyak sebebiyle gluteni (doktor onerisiyle) bıraktım, bir de laktoz intoleransım çıktı, süt ürünlerini de (neredeyse) bıraktım. Zaten et falan yemiyorum senelerdir. Yeni bir kafa yapısı, yeni bir beslenme biçimi yeni bir yaşam tarzı peşindeyim. Sevgiler.


Perşembe, Temmuz 02, 2015

isimsizlere yeni bir isimsiz

Internette gordugum ev fotograflari, dekorasyon siteleri, dekor fikirleri, baska insanlarin instagramda, facebookta vb paylastigi ev fotolari kafamda hemen ikiye ayriliyor, kediyle/ evcil hayvanla paylasilan evler ve digerleri. Bence evcil hayvanla paylasilan ev dekoru sitesi /blogu falan acalim. Evdeki esyalarin pek cogu, aman kediler bu camdan disari bakmayi seviyorlar, surada uyumayi seviyorlar, su dolabin ustune cikabilecekleri gibi bir raf koyalim yakinina, bu rafa bu ivir zivirlari koyarsak asagi atarlar oynamak icin, kirilir sonra, ya da ne beyaz koltuk ortusu mu puhaha aklini mi kacirdin mantigiyla duzenlendiginden evini hayvanlarla paylasanlar beni anlayacaktir diye dusunuyorum. Oyle iste.

Cuma, Nisan 03, 2015

tatil gunlerini niye seviyoruz adli post

kafamin icindeki clubber yine 'issstatistikissstatistikisstatistik' diye ritm tutuyor.
lisansta ogretilmeyen istatistikler siye sovmeye basliyorum, lan hadi lisansta ogretilmedi, yuksek lisansta yasam bilimlerine dogru kayinca sen kendin niye bir ders bulup almadin degil mi?

repeated measures datada, lineer regresyon ve comparing slopes gibisinden seylerle debelenirsin sonra boyle, bir de salak master ogrencisinin gotunden yalan yanlis yazdigi teziyle beyni yikanmis supervizorune isin aslinda tam olarak oyle olmadigini anlatmaya calisirsin, falan.

neyse efenim, basligimiza geri donersek, bugun paskalya tatili basladi ve ne super oldu bombos ofis bana kaldi :) sessizlik icinde calismayi ozlemisim.

bu haftaya damgasini vuran cilginli firtinadan sonra bugun gunes acti, iyi oldu boylece normalde tatillerde ofise gelecek insanlar da gelmedi sanirim :)

isstatisstikisstatistikisstatistik

neyse ben geri doneyim isime gucume...

Perşembe, Mart 26, 2015

bir de

hani germanwingsin ucagi dustu ya fransada, ucak kazasinda olmekten cok kafama ucak dusmesi gibi bir kabusum var benim evet, cok korkunclu tekrarlayan kabus serilerimdendir kendisi cok eglenceli(!) degil mi? bir bilincalti stili olarak donnie darko. Donnie Darkoyu izlemeden, Donnie Darko cekilmeden falan once de vardi bu tekrarlayan kabuslarim, filmden cok etkilendim de ondan oldu gibi bir durum degil yani.
Neyse.

it's been a haard daays night and I've been working like a doog

Gecenlerde 'iyey geymz, çellinc evriting' baslikli bi yazi yazmistim, basi soyleydi:

dun yine aksam vakti isten cikmis eve yuruyordum, cunku yogaya gidecek enerjim ve vaktim yoktu ve cunku kafam cok yorulmustu ve cunku yogaya gitmedigim ve bu hafta cok da spor yapacak vakit bulamadigim icin/ya da ozetle icimden gelmedigi icin diyelim vicdan azabi cekiyordum ve cunku stres dolayisiyla binge eating modunda oldugumdan yani ozetle stres yuzunden bokbogaz oldugumdan hem midem sikayet ediyordu hem de ayrica vicdan azabi duyuyordum cunku zaten cogu aksam eve yuruyerek donmeyi tercih ediyorum evet, yokus asagi, oh mis. Neyse iste, eve yururken sehir merkezinde yine siyah jant kapaklarinin altinda kirmizi jantli bir spor araba gordum ( sadece fren diskleri mi kirmiziydi yoksa komple jantlar mi derseniz, o karanlikta secemedim ama ben gorebildiysem bence komple jantlar kirmizidir, guzeldir falan). Kafamin icindeki ses yine yukarida soyledigim seyi fisildadi bana "iyey geymz, çellinc evriting" diye, ve evet farkettiginiz uzere bunu biraz aksanli yapti, napalim en azindan alman aksaniyla yapmadi bunu. Tubingen gibi kasaba sayilabilecek bir yerde o kadar o kadar o kadar cok luks araba, yeni araba, pahali araba, spor araba olmasi, spor arabanin burada yasli teyze fantazisi olmasi, bkz her uc teyzeden besine spor araba dusmesi, bkz tubingenin aslinda toy town olmasi, bkz misal Mazda MX5'in bir sekilde esantiyon olarak dagitilmis olduguna artik inaniyor olmam (need for speed demisken NFS undergrounddaki guzel arabadir ya Mazda miata, kafamin icindeki ses epey fisildiyor bana anlayacaginiz yolda yururken). 

Sonrasinda hayat nedir, akademide napilir, Almanyada akademisyen olmak, muhendislikten yasam bilimlerine gecen kafam neredeymis acaba,  gibi konularda serbest cagrisimla birbiri ardina gelen ve kacirilan dusunce trenlerini ucuca eklemeye calisan bir sicmik yazisi oldugundan kendisini yayinla tusu yerine taslak olarak kaydet tusuyla odullendirmistim.

Yani ara sira seni de kendimi de dusunuyor, yaziyorum sevgili okur, ki deli bir calisma temposuna girmis olmama ragmen yapiyorum bunu bak, ama kusmuk ve sicmik yayinlamak istemiyorum artik, bilmem o konuda anlasabildik mi?

Baslik farkettiginiz ya da etmediginiz uzere The Beatles'in A Hard Day's Night adli eserinden.
Gecenlerde akademide haftada 80 saat calismam gerek/ 80 saat calisiyorum miti uzerine bir yazi okudum, gotunuzden uydurmayin oyle seyler diyordu ozetle:
https://dynamicecology.wordpress.com/2014/02/04/you-do-not-need-to-work-80-hours-a-week-to-succeed-in-academia/

bi de gercekten calistigin saatleri bir kaydetsen oyle olmadigini anlayacaksin diyordu insanlara, ah sorunlarimizin cogu akademisyenlerin gercek dunyadan habersiz olmasindan, profesyonel yasamla hic alakalari olmamis olmasindan kaynaklanmiyor muydu zaten?

yani sabah 9 aksam 7 ofiste olman gunde 10 saat calistigini o kadar gostermiyor ki ozellikle akademide, yemek molasi, kahve molasi, gunun yarisini oyle ya da boyle konusarak gecirmek falan seklinde gidebilir o liste.

bir ara pomodoro teknigi ile calisiyordum, ofiste yemek saatleri haric 8 saat dursam bile max 6-7 saat calisabildigimi farketmistim.

neyse, ofisin oldugu koridorun ofisten sessiz olmasi gibi baska sotunlarim var benim, gunde 15 saat de calissam, sessiz bir ortamda 6-7 saatte yapabilecegimden fazla is yapamam herhalde, yani analiz neyse de okuma ve yazma kisminda tikaniyoruz.

Bir de dun twitterda soyle bir sey gordum cok guldum:




https://pbs.twimg.com/media/CA7ruQrUkAAcJv7.jpg:large

spm'de grup analizi icin dana once denemedigim  bir sey deniyorum, olmadi, blog arasi bittikten sonra donup onu cozmem gerek.

o kadar cok es zamanli projem var ki, yapmak istedigim binlerce yeni sey var, motivasyonum da var ama eve gidince pili biten energizer tavsani gibi oluyorum, koltukta bir seyler atistirirken dizi izleyip uyuyakalan isirganotu mode on.

cok ilginc konular var ama, kafamda yeni websiteleri bloglar falan var, bi gazagelerek baslarsam ne guzel olur. Bir yandan da doktora yaparken bi suru is basaran, uluslararasi sosyal yardim projeleri falan yapan insanlar var, bir de biz variz boyle iste,  amacim sikayet etmek degildi aslinda bu yaziya baslarken ama herkesi cok da ciddiye almamak gerek, sanirim bu konuda kendimi daha cok gelistirmeliyim. Insanlar bir seyler basaramadikca egolari buyuyor, saldirganlasiyorlar, arkadasliklari keyifsiz oluyor falan. Insan iliskileri en zor zanaat. Bi suru konuda kendimi gelistirmem gerek, doktorayi bitirdigi labda pinekleyip vakit gecsin diye bekleyen insan olmak istemiyorum ben, kafamda cok sey var yapacak. Oyle iste. Bir ara anlaticam, soz. Daha da guzeli, bir ara onlardan bahseden bir blog yapacagim, buraya bir yerlere de linkini koyacagim.

Ben SPM (Statistical Parametric Mapping- MATLAB'da norogoruntuleme icin kullanilan bir toolbox, hatta en yaygin kullanilanlardan biri) 'de grup analizi icin yazdigim batch skriptimde grup contrast manager kismi niye siciyor, niye istedigimi yapmiyor, sectigim secenek acaba dusundugumden farkli mi calisiyor onunla uğraşayım.  Ay cok heyecanli :D

Çarşamba, Ocak 14, 2015

Fieldmapping ile ugrasirken ben...

Yeni yil gelmis olm soylesenize. Neyse yazin yaptigimiz deneylerin sonuclarini analiz etmeye calisiyorum. Besinsizlikten midir vitaminsizlikten midir nedir salaga baglamis hissediyorum kendimi. E tabii motivasyon eksikligini de unutmayalim.
Gecen persembe sonunda endoskopi yaptirdim burasi yavas memleket oldugundan bu cuma falan biyopsi sonuclarini konusmak icin doktora gidebilirmisim. Gastrocu rontgen teknisyeni gibi calisiyor ben bir sey diyemem seni buraya gonderen doktora git dedi. Peki dedim napayim. Sedatif kafasiyla ruyamda modada yuruyordum, beni uyandiran hemsireye de e ben ruya goruyordum tadinda bir seyler zirvaladim. O kafayla ruyada modada gezmek makine seslerini de trafik gurultusu olarak ruyaya katmak sukela dogrusu. Sukela ne ya kendimden tiksindim bir an.
Of calistigin konu ve aletler falan hakkinda yeterli teknik ve pratik bilgi bulamamanin gozu korolsun. Neyse tek basima anlamak icin inat ettigim seyi sonunda harward in mi ne neuroimaging centerinin faqsu sayesinde anladim. En azindan bu da bir seydir.
Dun ucuncu hobbit filmini izledik sinemada ve utanmadan arlanmadan diyorum ki bence epey sikici ve uzundu film.
Radyoda yine wonderwall caliyor ve ben yine bagira bagira eslik etmek istiyorum. Bir de ergen is arkadaslarimin ofiste ergen deodorant sikip kikirdesmelerinden kurtulmak istiyorum cok mu?
Neyse ben spm manualinde fieldmapping kismini tekrar okumaya geri doneyim. Su datayi da analiz edip bi kac denek daha bulursam guzel seyler olabilir.
O zaman siradaki eksen parcasi hepimize gelsin: gold on the ceiling black keys'ten. O degil de neredeyse bir senedir kenarda oturan ukuleleme bi el atsam ya. Amanin en azindan yogaya geri dondum.
Bir dahaki yaziya kadar kib byys falanlar efenim

Pazartesi, Aralık 29, 2014

Flow, My Tears, The Policeman said

Baslikta gecen kitabi okumayi yeni bitirdim, sanirim bu yil bitirdigim son kitap olarak listelere girebilir kendisi.
Philip K. Dick ne güzel de anlatmis zamaninda senin, benim, hepimizin, siradan modern insanin kabuslarini, distopyalarini, bundan yaklasik 40 yil önce hem de.
Noel tatili, yani benim resmi olarak tatilim yok ama cogu insan sehir disinda falan oldugundan ise gitmesem de olur, ama bitirmem gereken isler de var gitmek de lazim o yüzden. Bir yandan da hava inanilmaz soguk, kar yagiyor falan filan iste.
Yazip yazip siliyorum, ben bi disari cikayim bari.

Pazar, Aralık 07, 2014

o degil de

eski yazilarimi okudum, ne kadar naifce mutsuz olmusum, siirler yazmisim, sarkilar dinleyip paylasmisim, espriler yapmisim. Kendimi cok mal gibi hissettim su anda, sanki önceden daha bir insanmisim lan.

akilsiz baslar vs yorgun ayaklar

neyse efenim, bi önceki yazidan devam: öncelikle 1 ay arayla iki partimsi verdigimiz icin insanlarin getirdikleriyle birlikte bir sarap koleksiyonumuz oldu ve an itibariyla evde sarap icen yok, evet.
sonraa, burada hava cok anlamsiz soguk. gece gündüz 1.3 derece civarinda seyrediyor, zaten tahminen 10 gündür falan günes de yok, e bari kar yagsin diyorum, insanlar üstüme yürüyor arada :D

sehirde cikolata estivali var ve benim cikolatadan itinayla uzaklasmam gerekiyor. Ac kalmak da gastrite pek iyi gelmediginden, dün disarida acikinca kendimi en yakin bakery'den bi minik ekmekcik (bagetcik) almis kemrirken buldum sokaklarda. Evden cikarken cantaya atilacak bir seyler hayat kurtarirmis.

Herkes noel alisverisi cilginliginda, cok sirin :)

Etrafta bir sürü güzel noel pazari (christmas market) var, gezmek lazim.

Bi de alakasiz da, mide sicarindan dolayi kahveyi (ve cayi, kafeini) biraktim, cok cilgin oldu. Yillardir devam eden kahve bagimliligimi birakmak ilk bir haftasinda rahatsiz ediciydi evet,  ama sonrasinda bir seyim kalmadi.

Soguk hava sayesinde bol bol film izliyorum bu aralar, o acidan iyi oldu. Dünden önceki gün predestination diye bir film izledik, güzeldi bence. Cok Nolanvari bir konusu vardi. Arada 3 ve Oh boy diye iki alman filmi izledim, onlar epey güzeldi. Movie night yapip milyonuncu kez mating habits of earthbund human izledik, herkes cok eglendi.

Yarin bir arkadasimin dogumgünü, annesi dogumgünü icin kendisine plakcalar aldi, ben de dogumgünü hediyesi olarak cok cilginli sarkilardan olusan bir Beatles albümü aldim :D Heyecan verici, umarim o da sever ve umarim onda yoktur ( Beatles sevdigini biliyorum evet tabii ki, mal gibi kiza gidip sadece kendi sevdigim bir sey almadim yani).

Neyse gideyim de izleyecek bir seyler bulayim, cok da uyku getirmesin cünkü yemeklerden sonra en az 4 saat beklemem gerekiyormus ve 3 saat falan yetmiyor, ve bir sekilde midemdekiler bütün gece orada takiliyorlar, sindirilmiyorlar bana kalsa.
bir aydir itinayla cekilen mide agrisina yenik düsülerek cuma aksami doktora gidilir, yaklasik bir bucuk saat bekledikten sonra bir güzel gastrit teshisi ve doktorun gevezelik arasinda korkutmasiyla ve iki tane cok "sirin" mide ilaciyla eve dönülür. Zaten bir aydir pek bir sey yemiyordum canim, sagol. Doktora yarin yine gidilecek, bu konusma daha bitmedi hem seni gastroenteroloji uzmanina gönderecegim falan dedi, hem de ben bir süredir pek bir sey yemdigimden kan tahlili yaptirmak istedim, etyemez oldugum icin de arada trip atmadi degil. Bir de cok yogunum epey beklersin, yaninda kalinca bir kitap getir oldu adam, evet hasta dolu bi odada beklemek gercekten beni cok iyi hissettiriyor, kesinlikle lan bu insanlardan kimbilir ne virüsler giriyor vücuduma falan diye düsünmüyorum, olur mu canim öyle seyler, sacmalama. lalalalala...

E peki ben nereden protein alacagim sevgili mofuyuminciklamakisteyensevgipitirciklari? Saniyorum bu mideyle baklagiller pek iyi anlasamadilar-denemedim degil. Tofuyla da iyi anlasabildiklerinden emin degilim, seitan deneyeyim desem zaten normalde de sindirimi zor bi kanka. Normal insan olayim, peynir yumurta falan yiyeyim dedim, süt ürünleri ve yumurta da mideyle iyi anlasamiyor, zaten bunca aradan sonra laktozsal ürünlerle midem saglam olsa bile bagirsaklarim siddetli gecimsizlik yasiyor. Abi bu inflamasyon sadece mideye has cikmayacak ve janjanli yiyecek intoleranslarim falan cikacak ya bence, hadi bakalim. Southparkla birlikte glutenfree manyakligina az gülmedik hepimiz, itiraf edelim, neyse artik napalim. Ofisten bir is arkadasimin 2 yil kadar önce saniyorum hemen her seye alerjisi cikti ( öncelikle fruktoz alerjisi var kendisinin, sonra laktoz alerjisi, soya alerjisi gibi seyler de cikti). Amaan, neyse.

Stres yapmaymis, tabii canim, demesi kolay. Ben bugün kosuya cikmadim ulan diye bile stres yapabilen bir insanim, onu napacagiz?Haftada 2-3 kere yogaya giderek bile anca bu kadar oluyormus bak.

Makale taslagimda süpervizörün verdigi düzeltmeleri bitirip ona geri yollamam gerek mesela, bir hafta oldu daha bitmedi.

Ya da  aman evde bos oturmayayim diye aciyorum courserada video izliyorum mesela.

Neyse, bir de keske aileme söylemeseydim öff aman ne vesvese yaptilar, sanirsin ki dünyanin en ender hastaligina sahibim, ulan hepinizin midesi sicmis durumda, farkinda degilsiniz belki ama kaaliiitttsaaaalllll!!!

neyse, yine dök icini rahatla platformu oldu burasi.




Salı, Kasım 04, 2014

isirganotunun anlamsiz kabuslari dükkani

o degil de, bir gün isirganotunun anlamsiz kabuslari dükkani acacagim, gelenlere her gün hikayeler anlatacagim, ya da baska biri anlatacak, yani esasen millet hikayeler dinlemeye gelecek, ben de yan hizmet olarak kafe gelirlerinden para kazanacagim, nasil? Bence tutar ya, ekmek teknesindeki kahvehane misali :D
z planindan da sonra z+1 plani olsun bu, cünkü z planimiz her sey boka batarsa izmire gidip kahvaltici acmak ya iste, ondan. Kedili kahvaltici oluruz en kötü iste, fena mi?
gecenlerde bir kabus olarak patronum A. laba daha cok insan aliyordu, yeni master ogrencileri neyim gelmisti, laan nasil sigacagiz cok kalabalik oldu nasil calisacagiz diye dertleniyordum rüyamda, kabusa gel. Napayim arkadasim, ofis cok ama cok kalabalik, yani birileri gidiyor diye sevinirken paso yenileri geliyor. su anda herkes ayni anda gelse 11 kisiyiz mesela, ki bi kiz baska binada calisiyor onu saymiyorum bile.
dünden önceki gün de kabusumda yogaya gidiyordum, yanimda kiyafet (bkz tayt) götürmeyi unutmusum, laan kot pantolonla da olmaz ki ama diye dertleniyorum, bu hafta bir kez eksik yoga yapicam diye.
ani biriktirmek lazim dedik ama gördügün gibi dünyanin en anlamsiz kabuslarini biriktiriyoruz, oysa su siralar bana kalsa kafam da bir rahat ki sorma.
ani biriktirmek demisken, 2. geleneksel cadilar bayrami partimizi verdik, filmlerimizi izledik falan güzel oldu. Joker ve Harley Quinn olarak couple kostümüne girdik, kiyafetler ve makyajlar el yapimi tabii, olayin güzelligi orada, amatör kostüm gecesi ve yarismasi yaptigimizdan dolayi :)
neyse ben laba gideyim.

Cumartesi, Ekim 25, 2014

Enjoy the silence bence

Radyoda enjoy the silence calarak beni yillar yillar oncesine goturuyor yine, artik aklima daha ziyade odanin kosesinde duran bilgisayarimin basinda gecirdigim sayisiz saatler, programlama odevleri dolu aksamlar geliyor. Etrafimdaki hirs küpü insanlarin bilgisayar konusunda bi bok bilmeyip ahkam kesmeye calismasi bana eskiyi daha da cok özletiyor sanirim. Neyse, bu da gecer elbet.

Epey once yazacaktim buraya, bir ay kadar önce. Diyecektim ki, hayatta ani biriktirmek önemli sey. Ani biriktirmeyi unutmamali insan. Eylülde iki hafta kadar Türkiye'ye gittim, aile ziyareti falan, denize günese kuma doydum azicik, sonra Istanbul'a gittim, H ve U ile kaldim 3 gün, H ile epeydir basbasa vakit gecirmemistik, cok iyi geldi. Onu anlatacaktim sana blog, sonra yillardir görüsmedigim cok eski bir arkadasimla bulustum, insanlarin young adult hayatina adapta olmaya claistigini görmek- acikcasi biraz rahatlaticiydi. Hem yalniz olmadigini bilemk hem de baska türlüsünün mümkün oldugunu görmek cok güzel bir his. Burada alman köylüsü is arkadaslarimdan biri- kendisini pek sevmem de- ay iste yasitlarimizin cocuklari var, ev yapiyorlar insan özeniyor gibi bir seyler dedi gecenlerde. Ev YAPIYORLAR ne laan, aliyorlar da degil, yapiyorlar, o kadar alman köylüsüyüz ki. Off...Sabaha kadar miyavlayan kedilerim bana, üstünü sagini solunu kapatarak kediler icin güvenli yapabilecegim bir müstakil bir bahcesi olan bir evde oturma istegi uyandiriyor, evin benim olmasi büyüklügü falan mühim degil, sadece istedikleri zaman disari cikabilsinler ve ben de güvende olduklarini bileyim yeter :)

Yarin yillardir hayalini kurdugumuz Neuschwanstein kalesini görmeyi yapilacaklar listemizden cikarmaya gidiyoruz, yeyy!

Burada sevdigimiz ve arkadas olarak gördügümüz insanlardan biri baska bir sehre tasiniyor, her akademisyenin kaderi sürekli yer degistirmek ve arkadaslarinin sürekli yer degistirmesi degil midir? Modern zaman göcebeliginin farkli bir versiyonu. Iki gün önce veda partisi tadinda bir sey yapti evinde, tanidigimiz hemen herkesi tanidigi halde (bizim labdaki nisanlar vb) bir tek bizi cagirmisti, diger cagirdigi insanlar da bizim gibi insanlardi, güzel bir ortam vardi. Labdaki insanlara söylemedim cünkü böyle durumlarda neden kendilerinin cagrilmadigni ve benim neden bu insanlarla hala görüstügümü anlamak istemiyorlar genelde, insanlar epey garip. Ha bir de bizim labdan da birinin veda yemegi gibi bir sey vardi, bir yilligina baska yere gidiyor, tabii baskalarini kendilerine tercih ettigim gercegine genelde epey bozuluyorlar- özellikle patronum. Süper pro bir iliskimiz var lab icinde, evet :D

Queens of the stone age I sat by the ocean diyor simdi eksende, ben de istiyorum ben de ben de diye bagirmak istiyorum!

H ile U, her sey yolunda giderse iki ay icinde Amsterdam'a tasiniyorlar, bu son zamanlarin en heyecan verici haberi!!! Herkes yakinimiza geliyor, ne güzel lan :Dy akin=vizesiz ve trenle gidilebilen yerler benim icin sanirim.

Epeydir pek film izlemiyorum sanirim, bu aralar pek kitap da okuyamadim ama Türkiyedeyken Buket Uzuner'den Su romanini okumustum ve bence cok güzeldi. kediler kadiköyler, samanlar falan güzel olur tabii benim icin :D

Yogaya basladim ve epey saridm, haftada 2-3 kere yogaya gidiyorum, hatta ingilizce ders yetmedi kadinin verdigi almanca derslere de gidiyorum, saniyorum almancam da gelisiyor biraz böylece. Aylik abonman aldim, böylece istedigim kadar derse gidebiliyorum. Vücudumda bilmedigim kaslar calisiyor ve esniyor, üstelik sirtim cok daha az kütürdüyor artik, yemin ederim genclestim resmen.
Bir de her modern insanda oldugu gibi saniyorum meditasyon bende de bir ihtiyacmis.

Ohoo eksen, simdi de Coldplayden Clocks caliyor, yine eskilere goturmeli.

 Ilk makalemin ilk taslagi bitti nihayet, bakalim daha üstünde ne kadar degisiklik yapacagiz. Simdi ikincisi üzerinde calisiyorum, datalarim hazir. Aslinda bir an önce bunun taslagini da yazmam gerekiyor, ve ücüncüsü icin de deneylerin yarisini yapmistik, o datalari analiz edip deneyleri tamamlamam gerekiyor. Ha bir de arada baskalariyla birlikte yazilacak en az iki hikaye daha var su an üzerinde calistigim ikinci grup datadan, yani in progress o kadar cok is var ve sürekli gerideymisim gibi hissediyorum ki, stres olmamak zor. Bir de patronum sürekli laf sokuyortrip atiyor falan bu konuda, sorma tadindan yenmiyor be blog. Ofisimiz cok kalabalik ve gürültülü, ergenimsi bir erkek grubumuz var sürekli muhabbet edip kikirdesen, sorma. Neyse pomodoro teknigi epey ise yariyor benim konsantrasyonum icin,  Bir yandan da ney falan dinliyorum, sözsüz müzikler buluyorum falan, napalim. Yazarken ve okurken cok zor oluyor yani, analiz yaparken belki o kadar degil ama.

Arada oktoberfeste gittik, inanilmaz kalabalikti tabii ki ama güzeldi, gerci bildigin panayir yani aslina bakarsan, ya da böyle seyler icin fazla uzun süredir almanyada yasadik sanirim.

Bu da bölüm sonu sarkin olsun canim, eksene sevgilerle:
https://www.youtube.com/watch?v=3Ip1irYWXck

Cuma, Ağustos 22, 2014

Don't Panic

gunaydinlar sevgili kendi kafasina gore takilan astronotlar ve uzay mekikcikleri

bu kadar nese dolu bir baslangica daha az nese dolu bir gunun sarkisi vererek devam edelim
https://www.youtube.com/watch?v=8uxt-FnNy2I
Ne de guzel soyluyor Coldplay, hepimize nostaljiler yaptiriyor, geri gelmeyecek gunleri hatirlatiyor, album ikibin yilinda cikmis olmasina ragmen bana ikibin bes civari yillari hatirlatiyor, muhtemelen hayatimda en cok o zamanlar coldplay dinlemis olabilirim, ondandir, istiklal caddesinde ve civar sokakalarda simdi varolmayan mukemmel cafelerde takilmayi hatirlatiyor, simdi kimbilir dunyanin kac bir yerinde olan insanlarla kitap tartismayi falan hahitrlatiyor coldplay.

aman neyse, nostalji yapmaya gelmemistim aslinda ama oyle oluverdi. Zaten pazar gunu otuz olacak olmanin verdigi bir mini stres var uzerimde- evet ota boka stres yapmak icin sebep bulan bir stres bagimlisiyim sanirim. Merhabalar ben isirganotu, ben bir streskoligim. adsiz streskolikler toplantisi yapalim online, herkese iyi gelir sanirim.

Aslina bakarsaniz kendimi ikna etmeye calistigim dusunce tarzi soyle, yasasin, otuza kadar yasamayi basardim!!! I made it!!! Ne kadar sakar ve kotu bagisiklik sistemi falan sahibi oldugumu bilen hemen herkesin yuzunde bir gulumseme olacaktir sanirim bu ifadelerle :D Inanmamistiniz degil mi yapabilecegime?

Dun hayatimda bir yenilik yapmaya karar verdim ve yogaya basladim. Bunda tabii burada ingilizce yoga kursu bulmus olabilmemin de katkisi buyuk. sirtimdaki her bir kas ayri ayri agrisa da guzeldi, devam etmeye karar verdim.

siradaki sarkimiz Garden State soundtrackinden gelsin (tabii ki bu sarkiyi filmle birlikte kesfetmis degilim, ama bu vesileyle filmi de analim):
https://www.youtube.com/watch?v=QD7qIthSdkA

Hadi icinden muzik gecen filmler izleyelim, cok rahat koltuklarimiz ve kitap kapli duvarlarimiz olsun, sarap sevmesek de sangriamiz olsun bir kenarda, mumkunse bol bol dostlar olsun etrafta, filmlerden kitaplardan muziklerden edebiyattan bahsedelim, oruc aruoba okuyalim mesela,  halil cibran okuyalm ne bileyim, dostoyevski okuyalim, almanca brecht okumaya calisalim falan. kicimizi kaldirip ukulele calmayi ogrenelim, bir kenarda sus dursun diye almadik degil mi?

Bleda'nin is bulmasi gibi sahane bir haber var arada, onu da atlamayayim. 9-6 tadinda bir is hayatina girdigi icin biraz mutsuz ama hayat boyle, yapacak bir sey yok.

bir de kedileri tasmayla gezmeye alistirdigimiz icin hem gururlu hem uzgunum. Umarim bir gun sonsuz bahcesi olan sehir merkezinde olmayan ciftlik tadinda bir yere tasinacagiz dunyanin herhangi bir yerinde ve gercek ozgurlugun tadini cikaracaklar.

son olarak bu aralar iki kitap birden okuyorum yine, William S. Burroughs"un Junky'si ve Albert Camus'dan Düşüş.  Guzel Kindle, cici Kindle diyorum ama arada kitap kokusunu, raflar dolusu kitaplarimi, onlari suursuzca karistimayi ozluyorum evet.

Isler gucler beni bekler, buraya gelmeyen yaz yuzunden eylulde turkiyeye gidip deniz kum gunes mi gorsem diye dusunuyorum ama hala emin olamiyorum. Bakalim.

Cumartesi, Temmuz 05, 2014

hadi hep birlikte hep birlikte biz biz olalim

Dün yan köy olan Rottenburg'da TU-CAGO isimli bir blues band dinlerken (hahaha, süper espri degil mi, sikago tükago) yine sunu yapayim bunu yapayim diye gazagelmisken kendimi hayatta yasadigim epiphanyler buradan romaya kadar yol olur laan diye düsünürken bulup bunu bir de telefonun not defterine not olarak düsmek. Zaten telefonun not defterinde en derin psikanalizler yatmakta bana kalirsa, paper notlari, konferans notlari, gidilen seminer talk vb notlari, kendi kendine notlar falan...
Bir de 'Laugh now, but one day we'll be in charge' dersem mesajin sahibi kendisini ve mesajinin bana ulastigini anlar mi acaba :D
aslinda bu mesaji sabahtan beri kurguluyordum kafamda, dün gittigim yan köy meydani kahvesindeki  blues brothers stayla amcalar grubundan ve nasil da ortamin yine en genc insanlarindan oldugumuzdan, nasil da surada aslinda en iyi anlasilacak grubun yine 68 kusagi amcalarla teyzeler oldugundan, yeni nesillerin nasil konservatiflestiginden, aslinda yasadigimiz yerin nasil da konyanin bir köyü konservatifliginde oldugundan vb vb bahsedecektim, üsendim yine. sonra tanimadigim biri blogumdan bahsetti bana bir facebook mesajinda, garip geldi falan.
öyle iste.
kendime not: müzikli filmler listesine sahane bir ekleme: Good Vibrations. Bir de kuzey avrupa yapimi polisiye filmler izlemeyi birak da tekrar feel good movies tadina dön, bak Walter Mitty misal, iki kez izlemek ne de iyi geldi.

Çarşamba, Nisan 09, 2014

Çarşamba, Nisan 02, 2014

Çarşamba, Ocak 15, 2014

what's happiness demisken sarkili post

https://soundcloud.com/ellekingmusic/playing-for-keeps

ya da bkz mad men teaserlari...
bir de ben ay sonunda turkiyeye gidiyorum, tam 1 yil sonra. bakalim neler degismis olacak, bakalim 1 hafta orada kalmak hayatimda ne bok degistirecek, falan.

what's happiness?

Mutluluk, elindeki ekitap koleksiyonunu arkadaslariyla paylasmaya karar veren canin arkadasin H.nin gonderdigi ekitaplar icinde, yillardir okumak istedigin ama yazarinin cani istemediginden yillardir baskisi yapilmayan ve ikinci eli yok satan o kitabin cikmasidir (isimler, kitap isimleri falan basbelasindan sakinmak icin yazilmamaktadir. zaten tahmin etmis olanlara ekstra ipucu: kitap/yazar yerli).
mutluluk turkce ne bulsak da okusak diye dusunurken elinde bitiveren birbirinden ilgi cekici zibilyon tane ekitaptir.
bazen mutlu etmesi kolay bir insan olabiliyorum ben de, evet.
vielen dank, thanks, tesekkurler, tak H.

Salı, Aralık 31, 2013

bu da yilin son postu olsun

bir süredir epey depresifim, düsününce pek de iyi bir yil gecirmisim gibi hissetmiyorum kendimi.
Bir de her zamanki gibi hasta oldum- soguk alginligiyla karisik sinüzit sanirim. Bir yilbasini daha evde pijamalarla gecirdigimi buraya not düsmek istedim.  Bünyeyi ne kadar strese sokuyorsak, dinlenince sapitan bir bagisiklik sistemi yaratmis bulunmaktayiz. Noel haftasi diye dinlenince hasta olmak.

neyse efenim yeni yil yeni yil yeni yil yeni yil siizlereee kutlu olsun, yeni yil yeni yil yeni yil yeni yil biiizlere mutlu olsun diyorum size, tahminimce yanlis yazdim ama anladiniz iste. bir de hic copy paste yapmadim, aferin bana.

kafamda cok cilginli yeni yilda yapmak istedigim seyler listesi, yilin sarkilari listeleri falan var ama halsizim. bir de ocak sonunda izmire gidecegim, bakalim tam 1 yil aradan sonra türkiyeye gitmek ne kadar sürreel gelecek bu zavalli bünyeye.

yeni yilda daha cok mutlu olmak, zamanimi daha iyi kullanmak istiyorum. Resmen bir yili tembellikle gecirdim ya da ben öyle hissediyorum en azindan.

hadi herkese yilbasi hediyesi olarak siber-sarilma hediye ediyorum- karsilik beklemeden. belki hep beraber daha iyi hissederiz.

Cumartesi, Kasım 02, 2013

(yaklasmakta olan) kis depresyonu ve kendine güvensizlik ve body size distortion arasindaki mükkemmelötesi baglantilar

bir cumartesi sabahi (aslinda gidip calismam gerekse de) de biraz keyif yapacaktim. dün de tatildi aslinda ama dün calismak istememistim, persembe günü evde mini bir cadilar bayrami partisi vermistik ve gec yatmistik ve bir kac bardak sangria icmis olabilirdik- bunu yazarken bu aksam da katilmamiz gerekn bir parti oldugunu hatirlamis olabilirdim misal. belki de b vitaminlerimi düzenli icmeyi unuttugumdandi bu blues ruh hali, kim bilebilirdi. persembe günü kendi partime gec kalma pahasina posterimin büyük bir kismini tamamlamistim, ama bugün de gidip kalan eksiklikleri halletmem gerekiyordu, cünkü süpervizörüm yarin amerikaya ucuyordu ve gitmeden önce görmesi gerekmekteydi, benim de posteri pazartesi baskiya vermem gerekiyordu ki, dünyanin en hizli bilisim teknolojilerine sahip olan canim ülke almanyada posteri baskiya vermekle alman arasinda gececek 1.5 gün, posteri gitmedn alip kontrol etmeme yetecek zaman versindi. Ha evet, önümüzdeki persembe amerikaya ucuyor olabilirdim ve bu yüzden epey gergin olabilirdim, epey avrupalilasmis olabilirdim bu konuda, dilini bilmedigim herhangi bir avrupa ülkesine gitmek beni germiyorkan amerikaya gitmek beni feci geriyor olabilirdi. san diegoda hava güzelmis ve pasifik okyanusunu görme serefine erisecegiz iste gibi konularla kafami oyalamaya calissam da aslinda transatlantik ucuslarda ucus korkusu yasadigimi kabul etmem gerekebilirdi.
ise gitmem gerekirken ben oturup dumandan köprüalti dinleyerek nostalji yapmis olabilirdim, sonra bir cumartesi sabahi keyfi nostaljisi olarak acip kanat atkaya okumus olabilirdim, sonra lou reedden perfect day dinleyip velvet undergrounda ziplamis ve favorim olan sarkilardan venus in furs dinlemis olabilirdim, oradan david bowiey uzanip defalarca space oddity dinlemis ve kendimi cok ama cok uzgun hissetmis olabilirdim. Hava bok gibi ruzgarli ve bulutlu ve kapali ve ayni anda gunesli olabilirdi ve arkamdaki koltukta uyuyan kedi horluyor olabilirdi (uykusunda mirildanan, horlayan ya da inleyen bir kedi kendisi, bi sürü kez kayboldugunu düsününce bazen kabuslari icin kendisine üzülüyorum). psikooglarla calismaktan sikilmis ve kod yazmaktan bu akdar uzak kaldigim icin kendime epey kiziyor olabilirdim, nereden tekrar baslayacagimi bilmemenin rehavetiyle oyalaniyor da olabilirdim. kendimi cirkin ve sisman hissediyor olabilirdim,  dün kosmus olsam da bugün kosacak vaktim olmayabilir diye dertlenirken, evde solitaire basinda -sirf is yapmamak icin- oyalaniyor da olabilirdim. Deadlinelardan nefret ediyor ve bir süre kendi kendime kalip kafami dinlemeye de ihtiyac duyuyor olabilirdim.
hepsi olabilirdi, oluyordur da belki, kimbilir. Ben gidip bir kahve daha yapayim, hazirlanip laba gideyim, gözümde büyüyen posteri bitirirsem kendime güvensizligim belki unutacagim kadar geri planlara düser, hissettigim rahatlama karsisinda.

Salı, Ekim 29, 2013

barcelona barcelona sen ne de guzelsin

bu salak alman koyunde cok sikilmistik, malum yaz tatili yapmamis olmak ve aylardir alman sinirlarinin disina cikmamis olmak bunyeye zarar, depresyon etkisi yapar falan. Ryanair kankamiz sagolsun, kendimize bi guzellik yapip gecen hafta iki gunlugune Barcelonaya kactik. Sehir guzel, kizlar guzel, jantlar neden guzel olmasin diye ozetledik 2 gunumuzu. Cidden hayatimda gordugum en guzel yerdi. Yasanir mi? Evet! Insanlar bok gibi degil , mutlular, sokaktaki kopekler mutlu (almanyada cok insan kopek besliyo ama kopeklerin cogu mutlu degil, kimse kuyruk sallamiyor). Sehir buyuk, yapacak cok sey var, cok gezecek yer var, cok turistik, kozmopolit, insan kendini ausländer gibi hissetmiyor. Bir yandan da misal, sehir merkezinde plajlar var! rüya gibi! denize girdik, güneslendik, kumsal cok güzeldi ve dünyanin her yerinden insan doluydu (arkamizdaki amerikali delikanlilar önümüzdeki belcikali üstsüz kiza yavsamaya calisirken ortada kalmis olmak sorunsali).
sonra bu boktan alman köyüne geri döndük- mis gibi yaparak yasayan pretentious insanlarin özenti elitist köyü.
barcelona benim icin, Brazildeki Sam'in rüyalari gibi oldu.  Asa ulasamayacagim ama cok süper mutlu bi hayat ve uyandigimdaki realitem bu boktan alman köyü.
neyse, haftaya da san diego yolcusuyuz bakalim, gidip poster hazirlamak gerek simdi. Böyle böyle her ay daha mutlu bir yere kacmak gerek, burasi cekilmiyor azizim. O yüzden para gerek, boktan phd maasi ile iki kisi yasayinca olmuyor o isler. kendime kizdigim kadar su dünyada.... neyse.
insanin hayattan bekledigi tek lüks gezmek olsun, daha da kötüsü su boktan düzende gezmek lüks bir sey olsun

Salı, Ekim 08, 2013

tasinmacali oyunlar

cok olmus yine yazmayali.
buraya kis geliyor bile, kistan once depresyonu geldi. cok sikiliyorum cok sikiliyorum.
arada bi suru guzel filmler izledim, itler gibi calistim, deney yaptim, ustume yikilan yeni gelmis phd ogrencisine yeterince sey ogrettikten sonra itinayla kendisine onun isini yapmayacagimi belli ettim, tasindik, yerlestik falan filan.
en son before midnight i izledim, serinin en guzel ve en gercekci filmi olabilir, ama bence kadinin karakteri sinir bozucuydu.
sanirim is yasamimda falan bir suru bossy insana katlanmak zorunda oldugumdan- welcome to academics- kisisel iliskilerde en ufak bi bossy hareket ya da manipule etme cabasi sezdigimde- ki bunun genelde bilmeyerek oldugunun da farkinda olsam da- hemen sinirleniyor ve topuklarim gotume vura vura uzaklasmak istiyorum bu insanlardan. 
bu boktan durum aslinda cok oluyor ya da ben buluttan nem kapar duruma geldim. 
tasindik, yerlestik. kediler evi cok sevdi- ev eski eve gore epey buyuk oldugundan olabilir, tum gun camda disaridan gelip gecenleri izlediklerinden de olabilir. epey bi cosy oldu ortam. salona tek kisilk yatak koyup yastiklarla kendisini divan haline getirmis olmamizdan da kaynaklaniyor olabilir tabii bu durum, zira eve her gelen yarim saat sonra uzanir vaziyette kedi gobegi seviyor olarak buluyor kendini. 
ha bir de sehir merkezi sayilabilecek bir yerde oturdugumuzdan gelen gideni bol bir ev oldu burasi, bu da guzel.
almanca kursuna basladim, bu sefer kursu degistirip yeni bir yerde basladim, buradaki ortam asiri asiri ciddi bana gore, sanirsin ki herkes alman olacagim gaziyla gelmis. 
onun haricinde, hala tatil yapamadim ve hala cok cok cok sikiliyorum. Tubingen effect: yeni insanlarla tanismanin zorlugu, olan insanlarla muhabbet etmenin zorlugu falan filan.
neyse ben kacayim da o region of interestler kendi kendilerine tanimlanmayacaklar deneklerin beyinlerinde. 

Pazartesi, Ağustos 19, 2013

guzel muzikli bir film daha

Dun high Fidelity izledim. Yine muzikleri guzeldir tadinda izlemeye baslayip sevdigim filmlerden. Siz sikici bulabilirsiniz belki ama hayat da sikici degil mi zaten? aman allaaam cok uber super aksiyonlu bi hayat yasiyosaniz da arada seyirci olarak davet etsenize, olur mu?
Bu siralar anlamsiz bir nes'e doldum. Sanirsam harbiden b12 eksikligi cektigim icin aptal depresif ve cekilmez bir insan olmusum, tekrar vitamin almaya baslayinca insan oldum. Yok en kotu ihtimal gider izmire yerlesiriz effect de olabilir bu, farkindayim. Doktoraya koymusum, size bir sey olmasin.
Belki de gecen hafta delicesine deney yaptigimdan, MR'da maruz kaldigim manyetik alanin bilinmeyen bir yan etkisidir manik ruh hali, hepsinin gideri var benim gozumde.
Aylardir okudugum kitabi sonunda bitirmeyi basardim, su anki deneyimin ilk asamasini bitirdim verileri analiz ediyorum, yeni ev sahibi sonunda tatilden dondu ve mail yazdi, izledigim filmleri seviyorum bu aralar, yarin Frankfurt'a gidiyoruz, amerika vizesi icin gorusmem var (sanirim 7 ay falan aradan sonra gokdelen gorecegiz, yeey! 3 aydir da buyuk sehir gormemistim, oyle dusun yani). Gecen yilki gibi cok cok iyi davransinlar, mukemmel sorunsuz olsun ve ertesi gun vizemi yollasinlar, olur mu?. Ben de biletimi de alayim ve okuldan butun bu islemlerin parasini alayim bir an once, hemen 10 gunde versinler.
yine dogumgunum geliyor lan, fazla buyuduk bence. burada sabitlenebiliriz.
burada evi teslim alirken ve teslim ederken bir protokol hazirlaniyor (devir protokolu gibi de janjanli bi adi var kendisinin). Neyse iste, boyle aman tmeiz birak evi, bal dok yala olsun falan tadindalar genelde. Ben de, bir ay sonra tasinacagimizdan, ufaktan ufaktan evi temizliyorum ki cikarken kolay olsun. 2-3 keredir delicesine banyo temizliyorum temizliyorum, fayanslari ovuyorum falan, delirecegim. o kuvet kenarindaki silikonlardaki sararma azalacagina artiyor resmen, ulan bu kadar pis insanlar miyiz diye kurt dustu icime :) Megersem eski, eski kiracilardan biri, pis silikonu temizlemeden uzerine seffaf degil de beyaz silikon cekmis, sirf o protokol kismini gecebilmek ve depozitosunu alabilmek icin muhtemelen. Ben de 'derinlemesine' temizledikce yuzeydeki silikonu kaldirmisim, altindaki pislik meydana cikmis. O kadar rahatladim ki anlatamam. Ha henuz bir cozum bulmadan bu kadar rahatlamis olmam da ayri bir mesele ama olsun.
Bir kod calistirdim ve eve gitmek icin bitmesini bekliyorum. sabah 5.15 gibi evden cikacagiz ve 9.15 gibi vize gorusmem var, bana bol sanslar. Neyse bari bir seyler izleyeyim, madem daha buradayim.

Çarşamba, Ağustos 07, 2013

tuhaf aile

disaridan bakinca, dusununce ne tuhaf bir aileyiz biz lan (normal aile diye bir sey vardi sanki de), biyolojik olarak bir bagim olmayan simdiki annem (sanirim halk arasinda uvey deniyor buna, hic sevmem bu kelimeyi, hakaret gibi gelir), bayram vesilesiyle dun kendi annemin mezarini ziyaret ettigini, ona torunlarini anlattigini ama bizim evlendigimizi anlatmadigini, unuttugunu, onu da bir dahaki sefere anlatacagini soyledi. Bu ilk kez de olmuyor, annemin mezarini 10 yildan uzun suredir ziyaret etmemisimdir, dusununce o benden cok ziyaret ediyor, hos annemi de benden cok taniyor, hatirliyor falan. ablamin ufakligi goturmek istemis, olmamis. Yahu cocugun aklini niye karistiriyorsunuz diyorum, anlamiyorlar. Benim cocugum olsa, kendi annemin olmus oldugunu falan cok sonra soylerdim herhalde, onemsiz bir sey yani bence torun acisindan. ulan ben annemi hatirlamiyorum, o cocuga ne? Ayrica ablamin ufaklik "annane'sini cok seviyor falan, niye cocugun kafasini karistiriyoz ki?
ben cok ruhsuzum sanirsam.